space invaders

link thumbnail E++
E++ is a portable, OO emulator. It is designed to be flexible and easy to extend. The current version runs under DOS only. This version has Z80 and 6502 cores built in, and emulates the
following systems:
  • Sinclair ZX Spectrum - With sound through your sound card,
    and Kempston Joystick support.

  • Space Invaders - With sound. Also supports Lunar Rescu ...
(Added 2006-08-08, 591 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 615 hits, more)
Search:

Tags

game gearc16c128manualtutorialmp3xzxcomputingvideo gamesspainstorytranslationscd32wiirpgsmagazinesculturecartridgetoshibagremlincodeclonesjapanarchimedesbluemsxincompletej2meseriessoftwarex68000mo5atari 8-bittoolchainngpdumpingpom1creatorsgenesis plus.netrzxcastawayrisc oscatalogvisual basicthalionsam coupĂ©neo geochip8sdkpv-1000llamasoftmoviescolemandroidmupengradiusinterviewsfrenchdownloadzorkfrontiermo6intellivisionvectrexpreservationonlinesource codetriviafanzineelectronhomepagestrategyvbaelitems-dosti-92pocketpc65816armzx spectrumdreamcastcalculatoratari stenesterosf/1flashpandoraasciiartx1fmsxmaking ofxm6fcenewslettersmodsinstallerszopharkim-1compiler6502box shotscopiersstudio 2martin korthnamcon64hexentoshereticbo zimmermanclubpsxpentagonconvertersddjstreamingarticlecompatibilityi18ncpup2000saturngithubzx81comicscharactersreplicascultimasg-1000mtxteosnatchervaxbiographyvideobooksfolklorescicd-isms pluswinampsquaresoftopengllinksgeocitiesmonkey islandqlmapsarchivedlittle johnrecompilershmupfpsesc-3000bard's talekonamipinoutswscopen sourceunreleasedgp2xpectrumcomposerslinuxhugues johnsonukscummvmpspsupervisionbabymarat fayzullinarcadiaencyclopediapc98auctionshistorygeneratordavid foxkegsgamesrom listingsblogsovietenginejrpgconversionfreebsddnamagazinebookdemo scenewindows cezx80collectionanalysisspecsintroductionxm7hintstimelineinterviewremakephilipsaquariusdosboxsoundtracksmac plusadventure gamegizmondoneo4allcartridgesvicesgbwinuaefdsprogramminglynxmaemorichard bannisterfan fictionfan gamesti-99/4aascii artoperating systembugsgermancolumnsmerchandiseaixrom hackingc64piratesmipswindowsnet yarozensfreviewskigbgrim fandangoto8scott adamsxboxcpcjeff minterhead over heelshandhelduae4allbasicnestechnotesbenj edwardsdatasheetsarchiveinterpreteribmfirmwarecivilizationcommander keenunderdogsfeatureibm pcpasswordscheatscocoaction replaymike daillyvideosremixesfm townsfusesharpmagickitff7gamecubemametrs-80ti-89romscamputers lynxcaanooodyssey2endingscopy protectionmarcel de kogelartworkreferenceosxlost sourcescreenshotsdocsebaycompressioncompetitionsolutionshandyto7walkthroughsgamasutrajumpmanemulatorneopocottgraphicsik+fan artmastertroniccommodoredelphijapaneseconsolesepsoninterpretersacornflyersuaegbapowerpcpokesnewsron gilbertdatabasedtvmac ospc-fxmulepsfpc-88game designrick dangeroustandygiana sistersaltairimageszaurusamstradadamssemmark3computersvirtual boytaitoqnxsegadarcnesps2quasi88guidestutorialsgifhparstechnicapatcheshi-scoressega cdiasf-7000sfccoversx86pointlesspublisher8-bitexcerptinfocomstellafaqmessschematicsmediagamepaul robsonlisatype-ingp2xspectravideofpgasharewarerainbowmetal gearthomquotesvcspalmostcp/iparticleswonderswanemulatorspodcastlucasartsharvestmacbeebsonicmanualscreativisionsidcommercialxgstrailblazerflashcartsmz-80os/2atomndstoolretrodevitalyresources3d realmsplayersmastergeardownloadsbiosmultifacesmsagiusemulation32xfrancefm-7cp/molafnesdemosformatspcwgbcdemopc enginepasopiapc-98sunosguiderom hackgalleryboulder dashfamtasiafrododiskmagsdoombbc basicmuseumboycott advanceradioduke nukemjum52fellowsimcouperemakesplus/4faqsyoutubewalkthroughwikipediacensorshipmiditvvic-20tnksmallcapcompeoplemega mandingoogermanyversionsabc80charles macdonaldedgenewsletterhitchhikergccpc-6000academicappleftponline playpetcolecovisionvgbphotosusenetfpceforumapple 2gsapple 2gplatarispace invadersneclibrarymega drivehucsierraidebeosatari800musiccollectingspritesitapogeeinfonesadsfinal burnwolfenstein 3dwikigp32apple 1bbcpsiondma designmaniac mansionz80descentscorpionbasicjswhardwarecomputersymbiansoundrpgid softwaremz-800nintendopcsxz-codeatari 5200toshiya takedajrpgstgemusnkfujitsu3dongpciosgamebasesonyabandonwareunmaintainedassemblerrom hackswizadventure gamespluginoricifcasiopdfsnes9xmasterdragontoolsshopcompilationssmartphonerotthumorarcadesinclairdebuggerngcdcps2mz-700luxorralph baerspace questastrocadeamigagame boyunixdottatari stsolarisshmupsnetworkingscansmailing listddrmagnetic scrollsgnuboyarnoldmsxindiana jonesneopopjavajaguarjupiter ace68kportfinal fantasynessdlnvgchronologyconverteratari 7800scumm