roms

link thumbnail Index of /packages/openmsx/roms
System ROMs for openMSX.
(Added 2012-10-08, 607 hits, more)
link thumbnail PDRoms
PDRoms is a website taking care of homebrew console, handheld and mobile phone software. We do have regular news service and plenty of downloads for plenty of systems. We usually do not report about commercial software, but might make an exception once in a while. Everything here is Freeware, Donation Ware, Open Source, Public Domain or has otherwise been legalized for free use by thei ...
(Added 2006-08-28, 368 hits, more)
Search:

Tags

compressionpentagonatompc98historynecarticlesiatgemuaction replaydottjum52compatibilitybiographybbc basicsdkbabychronologylucasartsrottjumpmancamputers lynxvirtual boymanualhomepagecomposersmega mangiana sistersmailing listbenj edwardsbookto7lost sourcefpgazx81biosc128gradiussdldtvpinoutspasopiax86namcomike daillycd-ingpcguidepreservationjrpgwalkthroughsspace invadersuae4allfolklorevcsbugscommercialdumpingcomputingacademicapogeegermantnkspritesinterpreterscartridgesllamasoftz-codemarcel de kogelik+vbasidfan fictionfaqshpgbcstellaxm6masterneopocottarchivemarat fayzullinrom hackresourcesemulatorsibm pcz80rom hackingcolemphilipssmartphonetutorialscummadamwikimagickitdelphihandyadventure gamegenesis plusopenglscreenshotsamstradddrfuselibraryonlineharvestwinampcompilerjupiter acecasiosaturnplayerstoolstechnotesmanualsidealtairfinal burnversionsmastergearopen sourceendingsatari 5200elitegp2xpectrumodyssey2gamespc-88tooluaecolumnsjavagp2xemulatormuseum68kapple 1cartridgegame boycatalogmaking offamtasiacompilationssmallspace questfmsxtutorialsinterpreterfpcecastawayarcadesunosreferenceosf/1mupencalculatorpatchesbluemsxemulationclubnewslettermaniac mansionnsfrecompilerplus/4mz-800computerscolecovisiongame designmoviesspainartworkgame gearquotesencyclopediapspseriesincompletepointlessdingoodownloadsconvertersvideo gamessolutionsfrontiersovietyoutubeusjaguarrainbowthomcommander keenpiratesultimajrpgsguidesvic-20hexencommodorescummvmvgbvectrexfanzinexboxarchivedsoundwizcollectionwindows ceneo geoacornp2000mp3clonesarticleunmaintainedti-89mtxjeff minterthalionsam coupĂ©3d realmsromsifbasicnesasciiartgifboycott advancedownloadchip8japanrpgjapaneseinstallersfellowwinuaesoftwareintellivisiongamemidicivilizationrpgszx80newsletterssinclairatari 7800githubdreamcastsonyimagesarstechnicahead over heelsgalleryaixpsxinfocomcps2mapswiirom hacksmagnetic scrollsdnafrenchdma designboulder dashcomicsexcerptwsctoolchainsf-7000fan gamesx1windowsgbacd32introductiondebuggerhumor6502xgsdragonssemmerchandisewikipediavideosneopopsimcoupeagismsapple 2little johnscorpionrick dangerousscansrichard bannisteri18nmipsbeosfirmwarephotoshintsvicecheatscopy protectioncompetitionhitchhikershmupspalmosdarcnesscikim-1pv-1000risc osradioarchimedestvgremlingizmondo65816retrodevdiskmagsnestergermanyedgeremakeatari 8-bitxm7atari stebbcmac osgraphicscodemetal gearatari800konamitranslationsunderdogsff7forumdatabasearm.netreplicasps2flyersshopadsonline playzauruscpupodcastmaemosc-3000bard's taleusenetarcadiaengineosxc64zx spectrumfm-7mamefeaturegamecubeschematicsarnoldluxortosgp32programmingmediacharles macdonaldcp/mebaysms plusinfonescapcomgnuboyabandonwaregamasutrareviewsgplibmhuccharactersstudio 2ron gilbertsonicvideohardwaremartin korthlynxmz-80descentsierrapokesmagazinemacqnxx68000newsbookshandheldsnes9xngpdocssega cdlisapocketpcsymbiankegsconversionsource codebox shotspom1teosfclinksapplefrodoralph baerpsioncpcmodspublishermesstype-inunreleasedformatsdosboxconsolessgbelectronmo6vaxsnkbasic3dosquaresoftbo zimmermanshmupsnatchern64ataristory8-bitpeople32xtcp/ipduke nukemiosvisual basicinterviewascii artapple 2gsdavid foxpc enginepdfwolfenstein 3dmagazinesblognescaanoongcdpc-6000datasheetsitfpsesupervisionti-92flashdemosinterviewsneo4allauctionsaquariusc16mac plusorictrs-80os/2paul robsoncollectingfrancestreamingportdemo scenetoshibanet yarozeandroidmusictrailblazerpc-98culturej2mequasi88adventure gamesscott adamscocokigbsg-1000psfms-dostoshiya takedaspecswonderswanspectravideowalkthroughcreativisionsolarissoundtrackssharpabc80passwordsepsonhereticjswtaitorzxfcendshugues johnsonpc-fxqlcoversmulepetddjpowerpcremakesti-99/4arom listingsatari stolafnescopiersoperating systempcsxzopharanalysispcwmultifacegeneratorfaqitalymz-700mega drivedemounixamigacomputernintendoconverterfdsto8fan arttriviafujitsuindiana jonesfinal fantasyzorkmonkey islandmsxsegasharewaregeocitiescreatorsxzxmark3astrocadeid softwareremixesmo5cnetworkingukgccgamebaseflashcartsfm townsgrim fandangoftpassemblertandybeeblinuxstrategyfreebsdcensorshiptimelinedoommastertronicpandoranvghi-scoresplugin