reviews

1 2 3 4 5 6 7 8 >   Next Page >>
link thumbnail Digital Press cool
Classic gaming fanzine, collector's guide, vintage systems knowledge base, reviews, media, regular columns. Covers an amazing breadth.
(Added 2003-11-12, 1541 hits, more)
link thumbnail GameFAQs cool
GameFAQs features video game cheats, reviews codes, and guides for all platforms, past and present.
(Added 2006-07-06, 920 hits, more)
link thumbnail I ♥ The PC Engine (Magweasel) cool
Kevin Gilford's excellent reviews of PC Engine games and related items providing a lot of historical background.
(Added 2014-03-04, 1274 hits, more)
link thumbnail SHMUPS! cool
Showcases the best 2D shooters around. Excellent reviews.
(Added 2003-11-12, 1156 hits, more)
link thumbnail Acorn Arcade
All about games for RISC OS computers. Hints, reviews, interviews, columns, and liberated games for download. Also has a demo section.
(Added 2006-08-17, 866 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 838 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 776 hits, more)
link thumbnail Adventure Classic Gaming
Dedicated to classic and retro adventure gaming. Reviews, exclusive interviews of developers and publishers, features on adventure gaming, and game cheats.
(Added 2006-09-24, 902 hits, more)
link thumbnail Adventure Games Coalition
Walkthroughs and reviews for many adventure games.
(Added 2006-09-24, 663 hits, more)
link thumbnail Adventure-Archiv de translate
Large database of adventure games with short descriptions, box and screenshots, and links to publishers, developers, related sites, reviews, and solutions.
(Added 2006-09-24, 1437 hits, more)
link thumbnail Amiga Flame
News and reviews of Amiga games. Also contains tips and cheats, demos to download and a section for game developers.
(Added 2007-12-10, 618 hits, more)
link thumbnail Amiga Games Database, The
Reviews of a great many Amiga games.
Welcome to the Amiga Games Database. It's purpose is to provide Amiga games players with an informed but subjective opinion on a wide range of games. A vast amount of Amiga titles have been written, some of them more than a decade ago. We've all come across some awful software in our time, but for many of us, there's a surprising quantity of undisc ...
(Added 2006-09-13, 648 hits, more)
link thumbnail Amiga Reviews ende
This site features thousands of Commodore Amiga game reviews which originally appeared in magazines between 1988 and 2000.
(Added 2006-09-01, 635 hits, more)
link thumbnail amstradmuseum.com enes
The Amstrad computers museum. Reviews (Spanish only), interviews, documentation, CPC 472 information, game inlays, small tape archive.
(Added 2006-08-11, 922 hits, more)
link thumbnail Area64
C64 games, demos, emus, utilities, and music. Games and demos with screenshots and reviews.
(Added 2007-01-06, 795 hits, more)
1 2 3 4 5 6 7 8 >   Next Page >>
Search:

Tags

scott adamsrpgskim-1flashcartsmupenarnoldcompatibilityidexgsplayersspace invaderswscmagnetic scrollscompilerpasswordsunmaintainedmega manconverterfamtasiaconsoleslynxrichard bannisterron gilbertpiratescocomipslost sourceharvestmagickitversionsid softwaremaccd-iinterpreterdma designsmartphoneendingssonyfirmwarepentagon6502magazinesphilipszaurusarcadedatasheetspaul robsonjrpgolafnessc-3000box shotssegafrancedarcnesneopopfmsxbeoscollectionresourcesvideosmailing listcomputingvideogremlincomicsshmupvideo gamesftpconversionmanualscps2lisa3dounreleasedwalkthroughsdtvfm townsinterpretersinfonesgeocitiesjumpmandreamcastunderdogssharpfolklorec16githubcamputers lynxencyclopediacommodorevaxrpgsidlucasartscastawayportsymbianqlp2000gifpodcastralph baerdemocharles macdonaldjrpgsddjgermanyartworktimelinessembugsastrocaderom listingsdnati-92cd32pdfspritesj2mepcwtosgiana sistersultimakigbmamestrategyluxorhugues johnsonaixgnuboycivilizationinfocomintroductionpalmosenginesega cdti-99/4agccmetal geargizmondotgemumonkey islandmo6smsphotosapogeedottsdlnvgstellacomputersandroidtype-insfccharactershpinterviewsmac plusdatabaseamstradtcp/ipbard's talegamebasetoolsuae4allcommercialfinal burnstorynecos/2assembleratari steedgepasopiaodyssey2fcehead over heelspetincompletecpuremakebenj edwardsbeebmoviesfanzine68kculturei18nboulder dashpublishermidipc-98rom hacksadventure gametutorialsdocsguidegraphicsarchivengpmarat fayzullinhistoryrom hackkonamipatchesgallerysharewareremixesfusemaniac mansionsgbcolemscansndshexenfeaturemike daillyboycott advanceonline playpointlessaction replayx1mac osfrodojupiter acegeneratormaking ofpc-88gradiuspc-fxatari 5200cpcxzxzx80net yarozebiosromscensorshipeliteplus/4solutionsdelphifan fictiononlinecomputerpc98flashnesauctionsnamcoabc80cp/mbookreferencefpseschematicsemulatorsmediacompressionscummvmfrenchsdkdemosneo georetrodevneo4allcaanooprogrammingdragonllamasoftpinoutscasioforumwolfenstein 3dcartridgereplicashi-scoresabandonwaremtxsonicwiipandorac64applemz-800scummbbcintellivisiontoshiya takedamega drivemultifacestudio 2quasi88mz-700newslettersam coupédavid foxgrim fandangothomrzxspectravideofpgadosboxapple 2gsstreamingflyersdiskmagsgp32gp2xpectrumadventure gamesmastergearx86gplchip8pc engineddrtoshibalinkspc-6000hardwarearchimedespreservationcheatsz80x68000osxarticlesnintendohucatari800winuaejeff minterarmgame designwalkthroughhitchhikeropen sourcecopiershandyimagescspainvisual basic8-bitatari 7800convertersamigagbczx81mark3osf/1rottmagazinejavadebuggercommander keenmuleunixtriviaadswinamparchived65816gbabooksguidesneopocottxm6copy protectionsnktoolchainatarijum52museumms-dosasciiartpcsxquotessmallbluemsxjswpom1colecovisionspace questfellowpsionibmrick dangerousti-89operating systemshopgermanmesshereticbbc basicpocketpcifradioagipv-1000faqmodsarcadiaqnxsms pluspeoplealtairmp3supervisionsnatcherapple 2analysisrecompilergenesis plussimcoupeseriescompilationscreatorsmo5interviewarticlewizacademicrainbowbiographylinuxtranslationsff7solarisz-codeduke nukemwikipediasnes9xiascorpionblogpowerpcplugincapcommasterdownloadngcdcomposershintsto8rom hackingvgbsf-7000atari storicfpcenewsnetworkingyoutubeibm pcngpcscibasicnesfreebsdhumormapstaitocartridgesjapaneseascii artbabyukthalionpokessovietindiana jonesrisc osacorngame boytechnotesuaenestermz-80tvc128viceto7squaresoftsg-1000installersvectrexgp2xtrs-80pspmastertronicmerchandisereviewsremakesfaqsfan artkegsepson3d realmssoundtracksdemo scenearstechnicaaquariusgamecubezx spectrumsaturngamesvcssunosdingooatari 8-bitexcerptzopharatomcoversfan gamesfm-7toolwindowsusenetcreativisionnsfhandheldpsxmarcel de kogelcatalogemulationn64game gearsoundmusicxboxxm7tandyfrontiercompetitionitalymartin korthspecstutorialmaemomanualwonderswanfinal fantasyvbacalculatorelectrondownloadsapple 1doomchronologyps2adamtnkbo zimmermancolumnsiosusmsxgamasutra32x.netbasiczorkebayopenglcollectingshmupsclonesformatsemulatorpsfteocodesinclairsoftwarevic-20dumpinghomepagescreenshotstrailblazerjaguarjapanvirtual boysierrafujitsuwindows cesource codeik+descentgameclubnewslettersitlibrarylittle johnwikifds