psx

1 2 3 4 >   Next Page >>
link thumbnail Romhacking.net cool hot
Comprehensive translation and ROM hack database and news site. Also features an abundance of programming information for many console platforms, with an emphasis on NES and Super Famicom.
(Added 2005-12-27, 5247 hits, more)
link thumbnail PCSX cool hot
Open-source PlayStation emulator for Linux and Windows.
[Source and binary downloads have been archived. Never thought I'd see this go off the air once...]
(Added 2003-11-12, 2630 hits, more)
link thumbnail NOT YAROZE cool enja
PlayStation programming in C/C++ without official tools.
(Added 2005-12-20, 570 hits, more)
link thumbnail pSX emulator cool
Monolithic PlayStation emulator for Windows and Linux/x86.
This emulator fully emulates the Sony Playstation. Compatibility is fairly high, most games I've tried work well.

An R3000 debugger is contained which may be of interest to people working on translations.
[Downloads have been archived.]
(Added 2006-07-06, 750 hits, more)
link thumbnail 4cheaters.de hot de translate
Large collection of hints and cheats for Acorn Archimedes, Amiga, Atari ST, C64, IBM PC, Sega Dreamcast, PC Engine, PlayStation, Game Boy, GBA, Super Famicom, Macintosh, NES, and others.
(Added 2007-01-09, 2368 hits, more)
link thumbnail Pete's Domain hot
Home of several excellent (and unmaintained) plugins for PlayStation emulators.
(Added 2003-11-12, 1375 hits, more)
link thumbnail AEC's PSX newbie coding section
An introduction to PSX programming.
(Added 2007-05-25, 610 hits, more)
link thumbnail aldostools
PlayStation emulation tools by Aldos Vargas
(Added 2006-06-28, 655 hits, more)
link thumbnail All PSX CAETLA Versions and CAEFLASH (PSXDEV)
PlayStation development tool for download that can be used on an Action Replay or equivalent hardware for development.
(Added 2014-11-17, 1733 hits, more)
link thumbnail AndrewK / Napalm : PSX
Some old and crusty PlayStation development tools with source code.
(Added 2003-11-12, 565 hits, more)
link thumbnail Andys Page
home of remakes of "Jet Set Willy", "Manic Miner", and "Lunar Jetman";
(Added 2006-02-10, 723 hits, more)
link thumbnail AVH'S PSX-DEV SITE
PlayStation documentation, source code, development tools, and demos.
[Most (but not all) files have been archived.]
(Added 2003-11-12, 677 hits, more)
link thumbnail bITmASTER´s pSXdEV
Sample PlayStation code, hardware documentation, schematics.
[A few documents are missing from the archive.]
(Added 2003-11-12, 732 hits, more)
link thumbnail Console Gaming World - PSX Utilities Index
Many PSX development and hacking tools.
(Added 2007-05-16, 622 hits, more)
link thumbnail Doc1
Several versions of PlayStation Action Replay firmware for download.
(Added 2003-11-12, 628 hits, more)
1 2 3 4 >   Next Page >>
Search:

Tags

winuaesoviethexentaitovic-20graphicsaquariusseriescomputerscaanoonesterc16vgbforumunixrottmidizopharwscemulatorgame boy.netmapsspectravideoconversionspriteshi-scoresdtvsonicfrodobugsrisc osmarcel de kogeltoolti-92programmingvideo gamespublishercp/mnsfngpcgermanycharactersarchivemp3arnoldmac plusmanualsbooksusdosboxboycott advancemaking ofhardwarepc-fxsfcralph baerdragoncommodoretoolchainmac oshereticatari stefolklorefusechip8pspneopocottcreativisionkigbultimacasiocatalogpodcast65816c128powerpcwindows cesoundluxorik+convertersfinal burntcp/iparcadeyoutubeto7duke nukempsionzaurusfceculturepc-88guidezx spectrumllamasoftmagickitstellatranslationspsxteotoshiya takedabookwalkthroughcomputingron gilbertmarat fayzullin3d realmsgplhpshopaltaircomicsunderdogscompilationscolemlinuxnewslettercompilerlibraryharvestmagazinecollectingintroductionresourcesgame gearhumor3dobo zimmermancreatorsflashcartssquaresoftpc-6000japaneseguideszx80net yarozecompatibilitytype-inp2000osxaction replaywalkthroughshomepageifgithubdnagp2xmartin korthremixesneo4allibmbard's talex1toolsodyssey2quotesshmupmo5open sourcedocsj2mems-dosdiskmagsi18nsnkvcscastawaydownloadscomposersmaniac mansiongbaimagessmartphonepsfmastertronicarticlesgamesdottsoundtrackszx81demoadamgbcngcdpalmoscartridgefaqtvbiographysegaabc80thalionstoryinstallers65028-bitrom listingsversionssgbsg-1000calculatorbeebfpgarom hackingatari 8-bitgamasutragiana sisterssharpspecsmonkey islandandroidnewsmoviesbiosatari 7800scorpionmagazinescpcwinampmetal gearitalylittle johnmega drivemerchandisemike daillysource codesierraendingsnetworkingdownloadsam coupésharewaregamegeocitiesgradiusmuseumti-99/4arom hackstudio 2ngpemulatorsmo6censorshipphilipsjrpgsfujitsutnkz-codecoverslinksamigamailing listtandypiratespluginmz-800pointlessidereferenceiaagiibm pcviceamstradxgshandyfamtasiabenj edwardsarcadiagnuboyschematicsuae4alldingoovideosfrancesnes9xcamputers lynxretrodevbox shotsabandonwareonlinelisatgemusidgp32capcomwindowscommander keenedgex6800068kmaemocompetitionnvgjum52cpumamemz-700passwordsfm-7delphioperating systemspainos/2tutorialwonderswanvideovectrexmipsdavid foxpom1jrpgquasi88enginesinclairboulder dashblogti-89fanzineopenglcharles macdonaldapplescummvminterviewpasopiarzxexcerptdatasheetskim-1unmaintainedsunosid softwareinterpreterspokesbasicnesdreamcastgame designtimelinefpceadventure gamescolumnsfeaturethomsdlpcwspace invaderssega cdjswradiomasterhucdemo sceneapple 2gstriviaplus/4mulepdfvaxportatarikegsunreleasedtosphotosrpgscolecovisionhistorymacshmupssc-3000infocomfan artdumpingx86freebsdlynxacademicbbcpetkonamibluemsxhitchhikerolafnesstrategycommercialadventure gamez80auctionspaul robsonmega manatari stmz-80flashpeoplefirmwarevbacollectiononline playsoftwarelucasartssimcoupescummpreservationpc-98consolesc64sf-7000flyersassembleratari800mastergearjaguarhead over heelspatchesascii artqleliteencyclopediassemxm6playerscps2multifacegp2xpectrumnesto8ebaymediamusicjavaromslost sourcechronologydatabaseepsongremlinusenetnewslettersgamecubecopiersmodsintellivisionbeosfan gamesneopopsnatchergamebasenintendoarchivedreviewswizvisual basicxboxdoomfmsxtrs-80jeff mintergermanzorkpv-1000tutorialscivilizationcartridgesemulationarstechnicababyfm townsrom hacksfaqsfpsewikiwikipediaelectroncd32computerddrtechnotesmsxukanalysisoricasciiartmtxcompressioncocogeneratorgifscisdk32xgrim fandangoarmcfan fictionpandorajumpmanbbc basicmanualatomfinal fantasysaturnreplicasspace questhandheldatari 5200ndspcsxcodepinoutsdma designpc enginehugues johnsonsmallrichard bannistergalleryosf/1rick dangerousjupiter aceformatsremakestreamingcd-iclonesfrenchdebuggerxm7astrocadesms plusitarticlescott adamsapogeegizmondowolfenstein 3dbasictoshibaneo geomark3copy protectionnecpocketpcfrontierapple 1supervisioniosrpgadsapple 2converterarchimedesgenesis plusscansmupenn64xzxftpuaeacorncheatsartworkclubdarcnesinfonesaixdemossolutionsgccremakessolarisinterpreterff7smsinterviewsps2indiana jonesfellowsymbianfdsscreenshotsmessjapanwiipentagonincompletedescentmagnetic scrollssonyrainbowtrailblazerpc98hintsvirtual boyrecompilerqnxnamcoddj