psf

link thumbnail PSF Central
PSF (Portable Sound Format) is a simple, flexible format for emulated music on a variety of 1990s-era and later game systems. PSF brings the functionality of other formats such as NSF, SID, SPC, and GBS to more modern consoles and arcade systems. By using the original music driver code from each game, sequenced music can be played in a perfectly authentic, and size-efficient, way....
(Added 2003-11-12, 723 hits, more)
link thumbnail Zophar's Domain: PSF1/PSF2 Archive
PlayStation music archive.
(Added 2007-04-01, 776 hits, more)
Search:

Tags

32xjum52preservationspace invadersneopoppcwfm-7osxhandhelduae4allrzxsource codeosf/1winampaixff7rainbownewslettersc-3000creatorszaurusengineinfocomti-92francecluxorchronologyapple 2p2000arcadiacopy protectiongp2xpectrumnvgremixespointlessmapsbeosz80coversn64frontiermarat fayzullinbluemsxencyclopediaifsovietromsmagazinesgamesmuseumretrodevxm6mastertronicbox shots6502apple 2gstriviacollectionpeopleassemblerdescentsnes9xebaymesslucasartsvirtual boyrpgmacastrocadescummvmhexensymbianneo4allandroidmoviescomputerslisapasswordsmetal gearid softwarexboxgizmondobbc basicpublisherfinal fantasytoshibaqlcopierscharactersstudio 2rottmastergearatari 8-bitsam coupĂ©biographykim-1.netharvestpdfquotesarchivemsxfeaturecartridgesbenj edwardsamstradj2memanualsonline playmupennamcocollectingbasicpc-98making oflinkssolutionsto7applemerchandisecapcomtooldarcneswizradiozorkrom listingsvectrexmtxmidineopocottms-dosmodswinuaeabc80sidpc98hugues johnsonmega manjeff mintercensorshippowerpcincompleterick dangerouswindows cefolkloremega drivetoolchainpc-88psxpentagonpinoutsinterpretersanalysispcsxdemoapogeegame designagisupervisiongame boygame gearconsolesforumbasicnesapple 1type-ingp32nesgrim fandangoiosflashcartstrs-80mac osfamtasianet yarozehucemulatoracademicpetfan fictionz-codesharpdatabaseabandonwareunderdogsssempandoratechnotesgccsonyintellivisionreferenceelitehpvaxgeneratorscummatari 7800snatcherdtvsega cduaechip8wolfenstein 3drom hackinggiana sistersdownloadsmagnetic scrollscommander keenartworkpv-1000c128strategyshopyoutube3dohomepagepasopiakigbaquariusarchivedwscsmartphonefm townsphotosboulder dashclubvcssms plusguidestcp/ipxgsadventure gamescolemxzxnewsaltairfcespecsgremlinsdlconverterexcerptcivilizationresourcestandynestercultureitalysfcfanzineinfonesremakesmike daillytutorialplus/4frodojapanesedemo scenecaanoogamecomputerdavid foxarcadecastawaygradiustimelinepodcastdnaoperating systemc64auctionsndsarchimedesopen sourcegbaos/2hitchhikervisual basicpspgp2xngpnintendotosron gilbertelectronlibrarycpumediamamejavacomicscamputers lynxscreenshotssmallbookssoundtrackssoundscanspaul robsonmaniac mansiontrailblazerjaguarpatchescomposerstaitospritescompetitionpc enginevic-20docssquaresoftgamebasequasi88babysaturnsonichi-scoresrisc osspectravideodma designasciiartspainarticlesinstallershintslynxsegaflashatarihandyoricc16ukatari800newslettersjswpocketpcfujitsugeocitiesmp3vgbi18nscott adamssunostutorialsdreamcastjapanpokesmusicgenesis plusgifcd-itvinterviewfan artsolarissg-1000bard's taleti-99/4amulejrpgsdumpingfreebsdplayersmz-700calculatorseriesrichard bannisterunixwonderswanunmaintaineddiskmagszx80ik+hardwareplugindelphiteocompressionzx81rom hackibmmo6streamingatari st8-bitversionsemulatorsonlinecatalogreplicasx86mailing list3d realmsacornpiratesps2ddrphilipssnkmultifacevideoftpemulationcomputingopenglzopharatari stearticlefirmwareindiana jonesgnuboywindowssciimagessgbadammartin korthgamasutrastellaiaralph baercps2programminggamecubearnoldflyersschematicsuspc-6000thaliongithubcolumnskegsmagazinefmsxlittle johnconvertersbugsshmupscodeintroductioncpcrecompilervideo gamesmac pluscheatssinclaircommodorenecinterviewsinterpreteradscompatibilitypsionclonescompilerscorpionstoryqnxmanualitibm pcodyssey2space questwalkthroughbloghumortranslationstoolslost sourcemasterusenetpalmosx68000cartridgesharewaremagickitaction replayto8monkey islandmaemobbcarmwalkthroughstoshiya takedagraphicsfellowformatszx spectrumamigalinuxpc-fxmarcel de kogelshmupfpgaidesdkdosboxatomjupiter aceportadventure gamewikipediaxm765816doommo5gallerysoftwareultimafusefdsrpgsnsfcompilationsdatasheetsremakegplboycott advancevideosjrpgcd32thomendingsbo zimmermanfinal burnconversionascii artolafnesdebuggerhereticneo geohistorybooksierrafaqsgermanymipsvicefaqdragonhead over heelsfpcegbctgemumark3smsbiosnetworkingcasiowiipom1dingoopsfti-89creativisionkonamisf-7000simcoupewikiatari 5200ngpcgermancocoguidecolecovisionfpsedownloadunreleasedngcdrom hacksduke nukemllamasoftx1mz-80frenchdottcp/medgetnkdemosvbacharles macdonaldarstechnicacommercialbeebreviewsjumpmanepsonmz-80068kfan gamesddj