nintendo

link thumbnail Nintendo Censorship cool
Detailed account of Nintendo of America's idiosyncratic censorship policies. Read everything about fascist dictator Master D. and the ruthless banana smugglers.
(Added 2007-06-08, 2636 hits, more)
link thumbnail Encyclopedia Obscura: Games
Games section of the Encyclopedia Obscura, a web site dedicated to the lesser known contributions to our (pop) culture. Strong focus on Nintendo games.
(Added 2008-04-13, 562 hits, more)
link thumbnail Kirby's Rainbow Resort
Introduction to the Kirby series, information on its creators, gameography, history and mythology, cameos, Kirby around the world, merchandise, scanned Kirby articles from Nintendo Power, and more.
(Added 2007-01-12, 456 hits, more)
link thumbnail Mushroom Kingdom, The
Super Mario Bros. downloads and information. Games, downloads, reference, emulation, articles, and more.
This site's goal is to bring you accurate, in-depth coverage about every Mario game, without ruining the fun of them.
(Added 2003-11-12, 834 hits, more)
link thumbnail Retro games
UK vintage software and hardware retailer. Not really cheap, but reasonable prices.
(Added 2006-09-02, 664 hits, more)
link thumbnail Technical Documents
Techdocs for various consoles and CPUs at Zophar's Domain. The Sega, Nintendo, and PC Engine sections are well-stocked.
(Added 2007-11-06, 375 hits, more)
Search:

Tags

multifacepentagonpandoraatari stescummvmdtvchronologyonline playrick dangerousdreamcastvaxneo4allsoftwarehandymsxfanzineonlinebox shotsdatasheetsfan artdemollamasoftintroductionviceversionsnesnecbookmastertroniczorkflashcartsmo6osxneo geoi18npodcasthppcw3d realmspc98windowscd32iospowerpcdumpingfpsearcadiagame boyscorpionarticlefirmwarestrategyflyerssidgccgeocitiesspace questelitestellaemulatorsinfonesfinal burnshmupnsf32xdebuggerdelphiguidesfcmailing listdescentlinuxsimcoupewalkthroughcomposersnet yarozeschematicsstreamingto7fcec64remakex1computingmipshandheldboycott advancesonycartridgez80manualibm pcjavasc-3000pokespasswords.netrom hacksgraphicsto8basicnesformatsmanualsindiana jonesvcssdlcodepsxsonicgizmondoconversionvideomiditaitocompetitionngpccompileragiemulatorsgbcopierssovietfaqatomarchimedes8-bitifzx80tcp/iposf/1appletutorialcommodoredemosc16academicrom hackpalmosndsapple 1censorshipaltairreferencecopy protectionhead over heelsgrim fandangognuboydma designcommander keendarcnesmastergeartype-inmaking ofn64pasopia3dodoompc-98z-codecollectionaction replayc128installersdragonbugsboulder dashlost sourcedownloadfusebooksmonkey islandvgbtoolfm townsatari 7800paul robsonneopopduke nukemlittle johnbeosjswremixessolutionsrpgbabyrpgsfdsgbcmessmusicgallerypinoutsx86aquariusretrodevnetworkingiagamescharactersamstradcompilationsresourcesrainbowpom1gbaarcadesms plusjaguarbloghistorybiographypspftpgame gearportremakesmulemp3cd-iartworkhucdiskmagspublisherkim-1lisascansbard's talexgsrom listingsvectrexteoopen sourcefrenchzx spectrumcivilizationcatalogjapanmega driveolafnestechnotessharewarecastawayjumpmanascii artabandonwareadventure gamesopengltrailblazerms-dospc enginegithubmupencgiana sistersmaemojrpgngcdconverterslibraryendingssinclairmoviescalculatorbiosarticlesphilipssdkcomputerssharpauctionsqltoshiya takedaforumhumormega mangremlingermanzx81incompletespriteswinuaequasi88armmediarecompilerwizinterpreterradioromsff7konamihardwareharvestron gilbertfinal fantasywinamppc-6000abc80docsjeff minterdatabaseplus/4tutorialsfan gamesfolkloreinterviewcompatibilityreviewssmartphonevideo gamesebayfrontierqnxgermanyrisc osbluemsxstudio 2vic-20x68000freebsdfm-7photosintellivisionsymbianseriescps2gplkigbnewsid softwaresnatchergenesis pluspv-1000gp2xpectrummuseumspecsrom hackingpocketpczaurusatari 8-bitngpplayersmark3creatorsflashxm6excerptmacgifgamecuberzxnewsletterbasicfrancescreenshotswonderswanbbcsquaresoftpatchestoshibamodsjum52guidescomputerbeebthomtgemuluxorpreservationmagnetic scrollsfaqscommercialti-92homepagehitchhikermarat fayzullinmagazinehugues johnsontranslationsmaniac mansionspectravideopc-fxitibmaixpirateswscmo5downloadsti-99/4asunosoperating systemdottmtxfeaturemetal gearsnes9xcolemarchiveti-89hintsmz-700ps2kegsnamcotrs-80consoles65816petapple 2atari 5200shmupsneopocottpc-88videoshi-scoreswiitimelinetandysf-7000gamebasemerchandisecompressionsg-1000source codegp32iderottwindows cenesterlucasartstoolchainadsshopadventure gameik+hereticpluginthalionelectronpointlesshexenemulationvbavirtual boycreativisiondingoomike daillydavid foxinterviewsmameitalydnaddjcolecovisionpdffan fictionwikicharles macdonaldtvxboxbo zimmermangamenewslettersunreleasedsierracp/mtriviacasiooriccartridgestosimagesunmaintainedvisual basicmaster6502martin korthcoversfamtasiasoundmagazinesjapanesefellowarchivedarstechnicacpclinksgamasutraedgesam coupĂ©adamrichard bannistermz-80storysegaodyssey2xm7atari stfpgafpcechip8columnsfmsxcamputers lynxspace invadersp2000gp2xapogeeenginesega cdcaanooasciiartanalysiscapcomdosboxustoolsmac osamigacomicsmagickitcheatssmallinterpreterscollectingos/2unixclubjrpgsandroid68kcocodemo scenewikipediamarcel de kogelsupervisionmac pluspeoplecpuastrocadepsionfujitsuscott adamstnkuae4allj2memz-800clonesxzxunderdogsralph baerultimaspainencyclopediainfocomepsonreplicasddrsoundtrackspsfconvertermapsacornsnkatarigradiussolarisfrodolynxbenj edwardsatari800zopharnvgyoutubeprogramminggeneratorgame designquoteswolfenstein 3djupiter aceukarnoldbbc basicnintendosmsapple 2gswalkthroughsuaeusenetssemcultureassemblerpcsxscisaturnscumm