magazine

1 2 3 >   Next Page >>
link thumbnail Acorn Electron Lives!
Dedicated to the Acorn Electron. Specs, expansions, hardware projects, game downloads, magazine covers.
(Added 2006-08-17, 953 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 792 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 737 hits, more)
link thumbnail Andy's ZX Spectrum Page
Magazine cover tape archive, Spectrum utilities for Amiga, documentation of Spectrum loading schemes, Your Sinclair Smash Tips booklets.
(Added 2006-08-11, 757 hits, more)
link thumbnail cbm264.com
Software and Information for your Commodore Plus/4 and 16. Downloads, GEOS, Scott Adams adventures, Tri Micro archive, C16 upgrades, magazine scans, systems and prototypes, Plus/4 service data.
(Added 2003-11-12, 632 hits, more)
link thumbnail Commodore Mania es translate
Commodore 64 page with games and applications archive, emulators, reviews, cover tapes, magazine scans, hardware mods.
(Added 2006-08-16, 966 hits, more)
link thumbnail Commodore Service Manuals
Service manuals for Commodore hardware in HTML format. Also Commodore magazine ads, schematics, and source code.
(Added 2003-11-12, 583 hits, more)
link thumbnail CPC Oxygen
Claims to be the number one online magazine for Amstrad computers. Also features an "Amstrad Action" magazine archive.
(Added 2006-02-24, 980 hits, more)
link thumbnail Digital A.N.A.L.O.G. Archive, The
scanned copies of Atari magazine A.N.A.L.O.G.
(Added 2003-11-13, 518 hits, more)
link thumbnail edicolac64 it translate
Italian Commodore 64 cassette magazine archive. Many Italian C64 games.
(Added 2007-01-10, 815 hits, more)
link thumbnail eZine X
Online magazine for Sinclair Spectrum fans.
(Added 2006-09-03, 534 hits, more)
link thumbnail FutureDisk
Claims to be the biggest MSX disk magazine still alive.
(Added 2006-09-28, 582 hits, more)
link thumbnail Happy Computer (German) de translate
Incomplete collection of German computer magazine "Happy Computer" at the Internet Archive.
(Added 2003-11-12, 1092 hits, more)
link thumbnail Immortal C64
C64 emulators, game box scans, wallpapers, Commodore Format magazine cover scans, top ten.
(Added 2007-01-11, 508 hits, more)
link thumbnail Juiced.GS
Quarterly print magazine focusing on the Apple IIgs.
(Added 2007-10-10, 1159 hits, more)
1 2 3 >   Next Page >>
Search:

Tags

pluginssemllamasoftrpgsmo6recompilerftpgbcjavaspace invaderspreservationtrs-80githubps2walkthroughsupervisionsnatcherwindows cevaxascii artcollectingclubwizbioschronologysdkdatasheetsclonesgamebasicmipsimagesstellasms plusff7c128snkcultureodyssey2ebaybabyrick dangeroussonyblogtimelinegenesis plussciron gilbertmaniac mansiondescenttutorialonline playdoomgp2xpectrumgame gearlinksmac plusx68000bo zimmermanvbatrailblazermarcel de kogelremakehexencensorshipnintendoneopocottz80folkloregremlinmanualspeopledemoendingsboulder dashtaitophotospsxpc enginewinampngcdtechnotesfm-7os/2pdfcoverssc-3000libraryemulatorbiographycheatscastawayopenglscansinterpreternamcoti-99/4asdlmartin korthinfonesversionsmonkey islandtoolchainmidivicefpcemuseumgp32converterartworkjumpmanadventure gamespom1patchesbox shotscodegamasutraitdumpingdemosto7fan artjaguari18nenginezx81analysisdingoolynxatari 7800marat fayzullinreviewscreativisionfinal fantasycd-iddjwalkthroughsretrodevlost sourceincompletewikipediagamesintellivisionscreenshotsamstradguidesdownloadssidpv-1000cartridgespowerpccomputersads65816net yarozescorpionhereticcommander keenmacopen sourcearnoldfaqneo4allcolecovisionms-dossource codexgsrainbowmusicgame designrpgiafan fictiontype-inmsxndscocoti-89hugues johnsontcp/ipfpgademo sceneencyclopediagamebasecreatorspc-fxhpapogeepinoutsarchivegeocitiesaquariusmanualfreebsdgermanytandythomgnuboypokesfrontier32xarstechnicapc98sonicrottrisc ossega cdchip88-bitdma designsnes9xspace questxzxapple 2gshardwarekim-1paul robsonx86commodorewindowspublisherinfocomvcsnesxm6frodofrancecasiounreleasedosf/1interviewp2000collectionusibm pcneopopmaemoidengpguideqnxdatabasegalleryddrolafnesintroductioncharles macdonaldunderdogsarcadecartridgepiratesrom listingsdragontossovietstreamingelectroncomposersjrpgmo5simcouperemixesjapanesearcadiawinuaecharactersplayersuaefcejapanhumorgermanpcwdottpocketpccommercialbeosphilipsgbaoperating systeminterpreterspodcasthead over heelsjupiter acenewsletterrzxgplfujitsucivilizationjrpgsmailing listcalculatorpentagonappletutorialsfaqsthalionjeff minterdtvbluemsxdavid foxaltairgizmondoukformatsfamtasiamulereferenceplus/4convertersgame boyfan gamesultimacmastertronicsam coupĂ©mp3specsmamednamz-80messvideo gamesralph baer68ktoshiya takedaflyerstnkmac oszx80compilationsgamecubeelitevisual basiccomputingdarcnesshmupscps2diskmagsfirmwarefanzineacademicseganeo geomagazinescapcomfrenchremakeshitchhiker3dobookmediascummcompatibilitymultifaceshmuprom hacksdownloadatari800magazineti-92smsatomsolutionskonamiemulatorsstudio 2smalltvpc-6000columnscaanoosolarisfusetriviamega manngpcsharewarehi-scorescompressionarchivedvirtual boycompetitionmodsj2mewiiwonderswankegszorkusenetuae4allkigbabc80archimedescpccopy protectionreplicasgraphicspsfpspapple 2xm7seriesjswfinal burnpc-88handheldmupenmz-700toolshucsinclairc16mz-800flashsoundtrackscd32pethomepagewikipandoraquasi88sierramerchandisesoundosxcomicsfeaturepalmosonlinebeebcopiersmetal gearcp/mmastergearacorngp2xcomputeradventure gamehistoryastrocadespainstoryradioyoutubeindiana jonessfcabandonwaremagnetic scrollssymbianifboycott advancepsionitalyfellowsf-7000giana sisterssunosnecmega drivedelphimike daillydosbox.netnewsletterscpuflashcartssaturnmapsgeneratorsgbpc-98armspritesamigalittle johnscummvmc64bugsandroidgrim fandangozx spectrummaking ofid softwaretranslationsjum52pointlessnvgasciiartauctionsxboxshopnestertgemuwolfenstein 3drichard bannisteratari 5200squaresoftqlzaurusbenj edwardsn64programminglinuxaixatari stcamputers lynxteoepsonsg-1000pcsxquotesconversioninstallersrom hackgifvideosfmsxinterviewscompileredgeibmik+x1masterschematicsvic-20vgbpasswordshandyportgccsmartphoneapple 1hintsnewsfm townsz-codebbcmtxconsolesatariadamoricunmaintainedarticlesmoviesassemblerarticle6502bbc basicrom hackingmagickitvideoemulationsharpharvesttoshibalisabooksfpsebard's talespectravideofdsscott adamscolemresourcestoolatari 8-bitsoftwareduke nukemlucasartsforumbasicnesgradiusluxorwscunixnetworkingcatalogdreamcast3d realmsdocsto8excerptdebuggerromsaginsfstrategyiospasopiaatari stemark3zopharaction replayvectrex