freebsd

link thumbnail iNES: Portable Nintendo Emulator
iNES is a program that emulates Nintendo Entertainment System (NES) and Famicom videogame consoles on your computer. It plays NES games on PCs, PocketPCs, Macs, Unix boxes, etc. The idea to write a NES emulator originated from Alex Krasivsky who found some Famicom programming information on the Net and wrote the initial code. At some point, Alex lost interest in the project, while I ev ...
(Added 2003-11-12, 838 hits, more)
link thumbnail MasterGear
Sega Master System (Mark III in Japan) and Game Gear, SG-1000, SC-3000, SF-7000, and Mark II emulator for FreeBSD/x86, Linux/x86, and Solaris/SPARC.
(Added 2003-11-12, 1057 hits, more)
link thumbnail TuxNES
[A]n emulator for the 8-bit Nintendo Entertainment System. Currently, the emulator has been tested on Linux, FreeBSD, and NetBSD, all running on i386 processors.
[...]
TuxNES is based on Nestra, a great public-domain NES emulator by Quor.
(Added 2003-11-12, 596 hits, more)
link thumbnail Virtual GameBoy
Virtual GameBoy (VGB) is a program that emulates the Nintendo GameBoy handheld on your computer. It runs GameBoy, Super GameBoy, and GameBoy Color games on PCs, Macs, PocketPCs, Unix boxes, etc. VGB also helps debugging GameBoy software without using a costly development system.

Being fascinated with GameBoy as a cheap handheld computer, I started writing VGB in 1995, afte ...
(Added 2003-11-12, 899 hits, more)
link thumbnail Virtual GameBoy Advance
Virtual GameBoy Advance (VGBA) is a program that emulates Nintendo's GameBoy Advance on your computer. It runs GameBoy Advance games on PCs, PDAs, or just about any other sufficiently fast computer. It also helps debugging GameBoy Advance software without using a costly development system.
(Added 2003-11-12, 627 hits, more)
link thumbnail Yabause
Yabause is a Sega Saturn emulator under GNU GPL. It currently runs on FreeBSD, GNU/Linux, Mac OS X, Windows, Dreamcast, PSP and Wii.

Yabause support booting games using Saturn cds or iso files.
(Added 2006-09-20, 630 hits, more)
link thumbnail ZSNES
SNES emulator heavily optimized for x86.
[This emulator has bugs that may not matter much when playing games but can cause serious problems when it is used for development.]
(Added 2003-11-12, 733 hits, more)
Search:

Tags

atomgraphicstrailblazerngpneopoprzxyoutubejrpgti-89lynxhandhelddatabasemo6babyx86newsletterpalmostutorialvic-20odyssey2applegame boy68krottendingsmanualscolumnsdemosastrocadepinoutsfan gamesms-doskonamirom listingscommercialgamebasearchimedesdragonsaturnsnatcherpaul robsonwinuaeunderdogs3doassemblervectrexhistoryrom hackjupiter acejaguargamasutraosf/1pentagoninfocomuktaitoneo4allmark3streaminghi-scoressegaromsradiohereticandroidbard's taleadsgeocitiesamstradvgbdavid foxcoversscansmo5smartphoneemulationcomposerstrs-80metal gearjswatari 5200camputers lynxbo zimmermansc-3000demo scenefinal burnik+introductioniosmailing listmz-80shopdownloadconversionjeff mintergamespc engineremixesfrodotechnotessoundtracksboulder dashcolemelitec16musicndsmp3msxinterpretersmartin korthaixjapanpc-fxdownloadswalkthroughswindowsversionslinksrom hacksindiana jonestoolchainwizllamasoftneopocottsunosmz-800symbianmagazinednahandyculturetvpdfitstudio 2winamptoshiya takedacps2ps2nvgqnxrpgconsolesddrsharpsonicbbcj2mecloneslittle johnsega cdgccamigapandoraemulatorcivilizationdelphisoftwareid softwaresimcoupetnkcaanooreplicasc128articlenecanalysisepsonto7grim fandangochip8olafnesexcerptcompatibilityguidecatalogdebuggercompetitionscreenshotsgermanhucseriesmessgamecubekigbcapcominfonesguidesapple 2gsinterviewsmoviesshmupsfeaturesupervisionsharewaresf-7000charles macdonaldfanzinebox shotsfreebsdnetworkinggermanysonyonlinesovietpom1richard bannistersam coupĂ©videomike daillyacademicmultifacedemoadventure gamemerchandisevirtual boyfpgaatari 8-bitspace questdma designgifcompilationsz-codefpcepv-1000wikispritesgithubjum52hpdiskmagsdreamcastzorkvcsxgsplayersinstallersarstechnicaarnoldluxorsolutionsmameflashfaqsfan fictionatari stmacplus/4snkcd32basicnescodebasicnesconvertermtxmaniac mansionresourcesgp2xpectrumscorpionunreleasedatari 7800copiersdarcnesmastergearedgeshmupibm pcnewsletterswindows cengpcrom hackingcalculatorforumthalionreviewsstellavaxgizmondoscott adamsarchivehitchhikerpsfarcadiamuseumbiographyjumpmandottlucasartssnes9xsms pluspc-6000frenchjrpgsbugsunixifti-99/4awolfenstein 3dpc-88portquotespointlessx1giana sisterspetzx81soundcomicsthomsidkim-1xm68-bitcollecting6502source codebiosmac osfrontiercusenetscummfan artgame designtoolspecsrisc osvideo gamespsioncp/mpluginfm townscartridgesddjcommander keenfaqstrategymz-700electronmastertroniclisahugues johnsonlinuxmulefirmwarex68000marat fayzullinpcsxvisual basichumorpsp3d realmspodcasttutorialsuae4allp2000italymac plussinclairdosboxvbadingoomonkey islandzopharreferenceoricblogcollectioncheatsteoopenglfcesmallpasopiacompileruspeopleemulatorsftpsolarissierranamcogameagicharactersretrodevmastergp2xtgemuidehead over heelspowerpcbenj edwardsformatsfusesdktoolsdocsdumpingvicexboxgplbbc basicbooksbookspectravideoengine65816ron gilberttranslationsintellivisionapple 1ff7atari800xm7colecovisionaltaircreativisionflyersgame gearremakesn64generatorsfchardwaremega manbeosduke nukempatchesadamoperating systemwscuae32xfinal fantasycastawaystorycompressioncocoaquariusgalleryboycott advancenet yarozenintendozx80apple 2rainbowgp32incompleteapogeewonderswansg-1000computerwalkthroughcreatorsscummvmhintsspace invadersc64imagespiratessdlmarcel de kogellost sourcearticlesfrancemagnetic scrollspocketpcarchivednestersmscartridgeibmmanualpc-98neo geogremlingenesis plusmagazinescomputerspublisherinterpreterxzxbluemsxpasswords.netmipsmiditandymaemosquaresoftpc98asciiartaction replayosxarmpsxi18ngbaunmaintainedcensorshipmupencpcsgbspainabc80rick dangeroustriviaatari stegbccd-iiaschematicsmagickitdtvqltoshibaabandonwaretimelinecasiomapsacornpcwfellowralph baeronline playmaking ofz80japaneseencyclopediainterviewharvestcommodoreconvertersnsfcpucopy protectionrecompilerhomepageopen sourcecomputingprogrammingfpsetype-inquasi88fdstosadventure gamesmediaatarizx spectrumgnuboyascii artlibraryjavagradiusto8remakeflashcartsmodsngcddoomfolklorewikipediavideostcp/ipti-92ultimapreservationfmsxzaurusdescentdatasheetsebaywiipokesartworkmega driveos/2photosfujitsunewsssemarcadechronologykegsclubfamtasiafm-7scibeebhexenrpgsauctionsphilips