flyers

link thumbnail Arcade Flyer Archive, The
Source for classic arcade video game promotional flyers.
(Added 2003-11-12, 1288 hits, more)
link thumbnail gamengai enja
Database of Japanese video games with capsule reviews, plus many flyers and omake.
(Added 2007-01-05, 743 hits, more)
link thumbnail SEGA-Network.de de translate
Das Informationsportal rund um SEGA Konsolen und Spiele
Hier erhaltet Ihr alle Informationen zur Geschichte der SEGA-Konsolen und Arcade-Boards, ihrer Technik, den Versionen, allen erhältlichen Spielen mit Cover, Screenshots, Daten, Cabinet-Pics, Flyer, Videos, Bewertung und Reviews, sowie massig Downloads von Spieledemos, Werbevideos und -anzeigen, MIDIs, Wallpaper, Game Co ...
(Added 2012-10-08, 1149 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 650 hits, more)
Search:

Tags

hitchhikerscummvmrom hacksjapaneseandroidnesiosunreleasedasciiartpsfhomepagefrenchsoniccasiomapsfan gamesphilipsinterpreterfolkloreadventure gamesgp2xpectrumssemgiana sistersadamxgstoolsjavastoryradiocomputingpasopiamanualwolfenstein 3dagiaquariussoftwareauctionshexendownload65816thalionguidepocketpcmultifacesf-7000resourcesapogeedownloadsbookscorpionhandheldinstallerscollectingemulationdottformatsibm pcfujitsucharles macdonaldcommercialbbc basicx68000mac plusto8ultimalucasartsgp2xfan artcompilationsebayaltairdavid foxconvertersrom listingsmac osbasicz80debuggercd32articlesgithubgbacolecovisionemulator68kbiographytaitovgblisacopiersatari 8-bitpc-6000x1triviaarnoldprogrammingtutorialsatari 5200clibrarycompressionpsxrom hackingsgbscott adamstechnotesrpgsmega manduke nukemtoolchainindiana jonesdemo scenesnes9xemulatorsgame gearnamcospace invadersrom hackoperating systemtoolmerchandisevectrexdragonvirtual boycartridges3dostreamingmediakonamifrodoj2mecreatorsz-codemacsinclairbiosralph baerelitesonyteogccatari stegermanyscreenshotsinfocomopengltospointlesszaurusmz-700porthi-scorespcsxsmartphonepatchesid softwarewinampstrategysc-3000soundtrackssoundpc-98sovietarchivedshmupsff7uae4all8-bitsource codestellasfcwsccompatibilityconversionvideoscummvideoscp/mmoviespokesmuleddrqlfamtasiabasicnesaixvaxcheatslittle johnscansbenj edwardsrzxschematicscaanoomagickitamigacpcfaqsarmpandorahintsopen sourceshmupcoversflashsegaspecsremakeremakesmike daillyik+podcastcivilizationmarat fayzullinromsrpgplus/4museumcompilergame boywiipalmosrottyoutubenet yarozeinterviewbbcsam coupégamescodediskmagscolemmanualsarcadiadatabasefpgavicefaqmasterdatasheetsmesstoshibapluginrick dangeroushardwaresg-1000introductionrainbowdingooidecomicsgifreferenceinterviewsdreamcastforumwalkthroughsierradnaonline playenginemark3tnkmagazinestutorialx86cartridgefceedgespectravideomusicclubrichard bannisterpublisherfmsxjapanartworkpentagonmz-800underdogssdlgermancompetitionorictranslationsusenetbookspc-88preservationluxorsupervisionfirmwarefinal burnwonderswanfrancechip8neo4allspainapplengpcfeatureto7sciarstechnicaapple 2gshereticgamecubemagnetic scrollsremixesfellowmsxnewslettershucdarcnesintellivisionpaul robsondma designflashcartscreativisionversionslost sourcexm7smallchronologyp2000wizdocssaturngame designunmaintainedhistorycomputerscopy protectionps2neopoptrs-80itnecwindowsfanzinegnuboycultureuaewinuaejumpmanharvestgeocitiesllamasoftgbc6502pc-fxastrocadepc enginemaemostudio 2collectionmipsrecompilerodyssey2fdscensorshiptandyrisc osxbox3d realmsfm-7petincompletespace questshopron gilbertataribluemsxlinuxbabyftptoshiya takedagizmondopv-1000ibmkim-1vbangcdvideo gamestrailblazergalleryosxkegsmastergearzophargeneratorseriesclonesmz-80epson32xngpaction replaysnktgemufpseretrodevsymbianarchimedesgamasutraatari 7800blogacademiczorkunixpdfatari stmailing listmaking offuseinfonesti-99/4axzxpinoutssunosgrim fandangozx81jrpgsdemosndssega cdjeff minterusbeebadventure gamefm townsimagesmp3monkey islandmamefreebsdfpceanalysisgp32tcp/ippsionreviewsmartin korthdescentphotosnetworkingitalycocopspolafnesamstradosf/1pom1iaboulder dashlynxendingssmsvisual basichugues johnsonnewsletterarticleguidesnewscastawaydosboxmo6os/2pc98jaguarmagazineonlinecalculatorcharactersmidiwalkthroughsdelphisdkhandyneo geojum52powerpcquasi88gradiusms-dosc16flyersukn64capcomdemoti-89catalogc64hpatomabc80head over heelsgraphicsbox shotsarchiveplayershumorgamebo zimmermanapple 1sharpgamebasebeostype-inmo5linksmtxquotesnestersharewarepasswordssms pluscommander keenc128zx80.netpiratesvic-20genesis plusboycott advancemupenfinal fantasymetal gearmega drivedtvcomposersdumpingacornelectronadssolarisconverterpeoplexm6computeri18nmastertronicascii artmaniac mansionfrontierifcolumnsapple 2interpretersconsolescpujrpgsolutionswikipediacd-itvneopocottjupiter acemarcel de kogeljswencyclopediaspritesdoomnvgnintendoabandonwarensfassemblersquaresoftsnatcherkigbfan fictionwikiatari800camputers lynxthombard's talecommodoresimcoupemodsqnxbugswindows cetimelinesidddjzx spectrumgremlingplexcerptreplicasvcscps2arcadeti-92pcw