famtasia

link thumbnail Famtasia ja translate
NES emulator for Windows with lightgun and FAM ROM image support. From Zophar's Domain:
Famtasia, previously called Famicom, is written by taka2 and nori. It supports the .nes, .fds, and a less common .fam ROM format.

It runs several games and has fair sound support. It also includes configurable support for non standard controllers, such as the light gun. Overall its pre ...
(Added 2006-11-17, 1034 hits, more)
link thumbnail Famtasia 5.1 Patch Vending Machine
Download a version of NES emulator Famtasia 5.1 with a custom set of patches applied.
(Added 2006-11-17, 578 hits, more)
Search:

Tags

fan gamesscott adamsteoneo geoneopocottdingoomac osunixi18nmupenresourcesbard's talemodsfujitsufanzinecpumac pluspsxcd32referencerick dangerousfdsgamasutramultifacemetal gearpsfeliteti-92ddramigasoundculturearmebayssemphilipsxm7museumboycott advanceron gilbertitfeaturearticlesgame designsimcoupebasicnesff7chronologyedgegp2xpectrumdatasheetsscillamasoftgcctnkx86aquariusascii artapple 1smallnintendomipsintellivision3d realmsmp3mz-700usarchivej2mesymbiandatabasepinoutsfinal fantasyz80coversstellacartridgesadventure gamegradiusartworkapple 2indiana jonesjumpmanincompletesoftwarecompilationssidromscocogamecubeapogeems-dossega cdifpetarstechnicaremakeiosmanualwinuaesnkpsionpalmoscreatorsvaxforumlibrarysam coupĂ©giffellowgermanfpgasaturnconverterbeebvbarzxclubaixblogonlinebeoschip8supervisionatari 5200namcopocketpccaanoocamputers lynxoricralph baerfolklorevirtual boyatari 7800sdkbox shotscheatstype-inplayersmagickitgraphicspc98vic-20duke nukemmacarticlehomepagepodcastreviewspatchessc-3000interviewcapcomquasi88source codeinterpreterkonamizorkconsolesconversionitalyadsboulder dasharchimedesosf/1jrpgopen source65816sharewarereplicastutorialinterpretersjum52seriestrailblazerngcdmtxgrim fandangolost sourcepointlessfpcegbazx81endingscd-ipc-98colecovisionarcadiahintshugues johnsoncomputingsonycp/mhi-scoresabc80compressionibmamstradtosbo zimmermanflashcps2formatspcsxpspdemoszopharuaemusicrecompilersg-1000wikiopenglcadamacademicx68000mo6ngpmarcel de kogelodyssey2atari steremixesdosboxandroidnestercollectingbiosluxorosxdocsastrocadepc-6000dragondebuggerdoomftpdemotechnotesimagestrs-80programmingmerchandisecartridgehpradiocomposerslittle johninfocomwiipluginjupiter acesinclairclonestriviaacornwindowspom1biographybookstoshiya takedacivilizationfm-7arcadecreativisionatomtoolchaindottspace questnectcp/ipjeff minterspace invadersid softwarebluemsxaltairplus/4downloadsquotesxgsschematicsshmuppowerpcjaguarwindows cegiana sistersmsxultimaflyerssmartphonehead over heelspc enginemule32xscanshandheldto7zx spectruminterviewsdna3dogame gearmediasovietwolfenstein 3dintroductionmagazineukcompilertvcompatibilitypdfauctionsjapanesepiratesdarcnesarnoldnet yarozedma designemulationnewslettersnvgyoutubeto8sf-7000unreleasedcasiolinkstgemuzx80applerottxzxsolutionssfchucrpgscopy protectiontutorialsfmsxagifrancehumorneo4allguidestrategyconvertersportmesscpcdiskmagsvcsneswscencyclopediamike daillylisaabandonwarefrodomaemofcespecsn64online playdreamcasthistoryfrontierspritesdescentscorpionlynxretrodevp2000generatortimelinebasicpaul robsongizmondostreamingrisc oscensorshipfinal burntaitongpcshopinstallersjrpgsstudio 2pc-fxndsengineasciiartxboxos/2computerscopierscharles macdonaldhexentandygp32marat fayzullinpandoramz-80mamerom hackingcomputerfusemagazinesdemo scenehereticfan artcharactersc128usenetflashcartsmonkey islandxm6gbcvideo gamestoshibaremakeshardwareguidesmaking ofrom hackkigbgithubfirmwarecommander keendavid foxcompetitionoperating systemcastawaywonderswansolarishitchhikerlinuxdelphiibm pcspaintranslationssierrapublisherphotos8-bitrpgbugsmidimaniac mansionmoviessnatcherpasswordsmz-800assemblerddjshmupsqlwikipediakim-1bookstorysdlsgbatari800benj edwardspentagonthomgp2xgenesis pluskegscolemmagnetic scrollsmasternewspc-88mega drivepokesgeocitiesmega manjavaolafnesemulatorgallerybbc basicmark3manualscalculatorgamebasedownloadunmaintainedepsoniaharvestfaqlucasartssmsjapan6502pv-1000sonicx1preservationvisual basicc64vgbgremlingamesrom hacksrichard bannisterversionsti-99/4aarchived68kjswvicedtvtoolsmartin korthzauruspasopiawalkthroughnetworkingwalkthroughsgamegplemulatorsneopoprom listingsthalionwinampwizatariapple 2gsmapsfamtasiamailing listcodec16.netaction replayfm townsspectravideopcwfrenchsms pluspeoplez-codecomicsfan fictionnewslettersnes9xmastertronicuae4alladventure gamesgame boyvideoscatalogatari stgermanyhandygnuboysharpcommodoreexcerptti-89mo5segaanalysisvectrexrainbowvideoscummvmfpsesquaresoftbabyfaqselectronscreenshotsqnxcolumnsinfonescommercialtoolmastergearfreebsdsoundtrackscollectionideunderdogsik+scummbbcdumpingps2sunosnsfatari 8-bit