academic

link thumbnail NES496
Incomplete NES emulator/debugger for Windows.
This NES emulator was coded as a result of a college assignment in CSE496, hence, the name NES496. It uses DirectX for drawing the graphics. It has partial sound, is rather slow, and only supports a few mappers. It does, however, have a cool graphical debugger. It's not really worth the download right now unless you want to play with the d ...
(Added 2006-11-23, 589 hits, more)
link thumbnail Project 51
NES emulator for DOS with sound but limited mapper support.
[Downloads have not been archived; get them at Zophar's Domain.]
(Added 2006-11-25, 505 hits, more)
Search:

Tags

jrpgadamtnkzx80tosxm6linuxcommander keenpc-98ff7jeff mintermo6jaguarsoundtrackstutorialsgbcneopophintsvisual basicandroidguideamigawiitoolchainodyssey2ukstreamingwscshmupsibm pcdemo scenemaniac mansionreviewsfirmwaresega cdcreatorsdtvcultureduke nukemunreleasedlynxpirateswolfenstein 3dgizmondoqnxmipssgbarstechnicatandyrzxatariquoteshucgame gearzx81beostriviasf-700068krick dangerousradiosimcouperom hackz-codeuaesnkgermanvirtual boyreferencecputrailblazersmartphonelisaosf/1imagesgp2xsg-1000mz-700hi-scoresnetworkingcd-ipc98ti-99/4azauruscheatscps2messhandheldwindows ceaquariusmac pluspodcastelitehandymagazinepreservationbbccatalogabandonwareascii artgamebaseemulationmarcel de kogelmarat fayzullindebuggermultifacepc enginecensorshippokesmo5programmingx1featurendsaixlibraryretrodevatomremixesj2mesunosincompleteatari800folklorepdfjavatcp/ipblogbugstimelineidegremlincommercialsnatcherjumpmanadventure gamesralph baerforumzorktrs-80wikiosxoriccd32c64hereticunixddjplayersmaemo3d realmsunderdogsbabyspaininfocombasicnespcsxwinampdownloadmastergearsource codevgbadventure gameastrocadeitauctionsnewszx spectrumustoolscharactersarnoldsmallto7mupento8neopocottgamasutraxboxkim-1commodorearmthalionpeoplecocofrancevideosdma designgccfcestoryrom hacksgameopen sourceatari stecaanooflyersatari 8-bitclubscummnamcohistorypasopiassemjapantype-injswnespasswordsmagazineshugues johnsonagifinal burnps2ti-92doomcartridgesmacneo geocompressionifdavid foxflashcartsibmstellayoutubegp2xpectrumsmssnes9xxm7applecolecovisionsoftwarepetron gilbertcodegraphicsvicedatabasesfcacornrainbowunmaintainediaintellivisionelectronabc80edgex68000interviewskonaminsfpaul robsoncastawayn64coversfdsspectravideogp32modsid softwareti-89frontierbooksplus/4x86bookfreebsdms-doshumorcopiersflashinterviewgallerysc-3000faqscompilershmup3doftpscorpioncreativisionpinoutstvjum52columnsnesterspace invadersharvestcluxorultimareplicasarcadetaitoopenglkigbcasiomediap2000emulatorgeneratorinterpreteranalysisfan artfpsepalmosseriesmastertroniclost sourcexzxvic-20space questbiosrpgmaking offmsxthomnecapple 1action replaysolutionsclonesdingooatari 7800conversionarticlehead over heelsfm-7pom1neo4alllucasartsxgstutorialjupiter aceassemblershopcapcomllamasoftdarcnescolemfusemartin kortharticleschronologysms pluscalculatorremakescharles macdonaldapple 2gsspecsrichard bannisterdatasheetsvbagermanycivilization65816excerptguidesformatslittle johndocsconverterswonderswanfpcemanualdumpingjapanesedownloadscartridgeusenetwalkthroughschematicsdemosamstradpointlessonline playnvgencyclopediasaturnsam coupébiographypsionscanshitchhikerik+mac oscomposersrottsharewaretoshiya takedacollectionscialtairmark3musicbenj edwardssdknet yarozegplmamesinclairboycott advancefinal fantasysupervisionfanzinesolarisiospowerpcvectrexmasterepsonhardwarerpgsscott adamszopharendingsinterpreterscopy protectionfellowmp3spritessonicmerchandiseapple 2hpi18nmailing listoperating systembbc basicresourcessidcomputerconsolesmapsz80pocketpccomputingc16technotes8-bittranslationsromsonlineasciiartgamesfan fictioncompatibilitymsxtgemudreamcastinstallersgame boyadssdlebaywikipediac128newsletterpublisherdescentbo zimmermancp/msquaresoftporttoolscummvmarchiveditalysovietcpcfm townsfpgafaqdnaarchimedesngpcgiana sisters32xhomepagewalkthroughsmonkey islandmega drivedragonvcssharparcadiabasicbard's talegrim fandangopspmike daillycomputershexenpc-88french6502metal geargnuboydemointroductionteophotosos/2fujitsuatari starchivevideoapogeegeocitiespatchesngpmuseumpcwpc-fxnintendopandoramanualspentagonphilipspluginrom hackingkegsmz-800box shotscollectinggame designmz-80gbaatari 5200sonyfan gamesvideo gamesddrvaxbeebscreenshotsstrategydottfrodoacademicindiana jonesgithubemulatorsmoviessierragenesis plusdiskmagswinuaetoshibacomicssegaremakedelphifamtasiasoundsymbianmagnetic scrollsconvertercompetitioncamputers lynxmagickitinfonesquasi88mulepsxolafnespc-6000.netrecompilerboulder dashdosboxwizgamecubechip8mega manqlwindowslinksnewslettersversionsrisc osartworkngcdstudio 2jrpgsmtxgifuae4allmidicompilationsrom listingspsfbluemsxgradiuspv-1000engine