x86

link thumbnail bee
bee is an emulator of several video game systems. It currently emulates the "Sega 8-bit systems" Master System, ColecoVision, and SG-1000, as well as the Atari 2600/VCS. More systems will be added in the future.
bee is designed to be portable, accurate, and easy to use. At this time, the program is available for Windows, Mac OS X, and Linux x86.
bee emulates hardware mostly ...
(Added 2008-07-12, 639 hits, more)
link thumbnail BeZX
Sinclair ZX Spectrum emulator for BeOS (x86 and PowerPC), based on XZX.
(Added 2006-08-08, 683 hits, more)
link thumbnail Bochs
The cross-platform IA-32 emulator.
Bochs is a highly portable open source IA-32 (x86) PC emulator written in C++, that runs on most popular platforms. It includes emulation of the Intel x86 CPU, common I/O devices, and a custom BIOS. Bochs can be compiled to emulate many different x86 CPUs, from early 386 to the most recent x86-64 Intel and AMD processors which may even not reac ...
(Added 2003-11-12, 522 hits, more)
link thumbnail BSNES (Mac OS X)
Super Famicom emulator for Mac OS X that focuses on accuracy over performance. No source code provided.
(Added 2006-08-17, 708 hits, more)
link thumbnail Dioscuri
Modular IBM PC emulator written by the Dutch National Library.
Dioscuri is an x86 computer hardware emulator written in Java. It is designed by the digital preservation community to ensure documents and programs from the past can still be accessed in the future.
(Added 2007-08-20, 562 hits, more)
link thumbnail ec64 - emulated C64
Although there are very good C64 emulators already available, i've started my own emulator project in July 1999, called ec64 (emulated C64). It behaves like a C64 with an attached C1541. The emulation works cycle oriented. At the moment ec64 runs under Linux on x86 architectures only. As the date of the latest news suggests the development of ec64 stalled. Unfortunately i haven't the t ...
(Added 2003-11-12, 478 hits, more)
link thumbnail Higgins
Sinclair ZX Spectrum emulator for Linux/x86.
This ZX Spectrum 48K/128K/+2 emulator is dedicated to provide you the sense of a real Spectrum machine, as it was (and still is) in real life. The stoutness and precision are our major objectives, just like in Snooker.
(Added 2008-05-16, 413 hits, more)
link thumbnail Starscream
68000 and 68010 emulation library written in i386 assembler. This engine is used by a large number of game console emulators.
(Added 2006-07-06, 515 hits, more)
link thumbnail TuxNES
[A]n emulator for the 8-bit Nintendo Entertainment System. Currently, the emulator has been tested on Linux, FreeBSD, and NetBSD, all running on i386 processors.
[...]
TuxNES is based on Nestra, a great public-domain NES emulator by Quor.
(Added 2003-11-12, 455 hits, more)
link thumbnail XFellow
Unmaintained Unix/X11 port of DOS Amiga emulator Fellow.
XFellow is a port of the Fellow Amiga Emulator to Intel based Linux systems.

Features

Some of the features of Fellow (and therefore XFellow) include:

  • Almost complete emulation of the 68000-based A500, with some features from other models (e.g. ECS blits, 68010, ...
(Added 2006-08-17, 599 hits, more)
link thumbnail ZSNES
SNES emulator heavily optimized for x86.
[This emulator has bugs that may not matter much when playing games but can cause serious problems when it is used for development.]
(Added 2003-11-12, 588 hits, more)
link thumbnail ZX Spectrum emulator for Linux/i386
You can get the sources for my Spectrum Emulator here for Linux on a 80x86 processor. The emulation itself is made in 80x86 assembly and so very fast even on old computers. It works under X11. It emulates the ZX speaker with /dev/audio. It can read sna and z80 files.
(Added 2006-08-29, 376 hits, more)
link thumbnail ZX4ALL
Sinclair ZX Spectrum emulator for Dreamcast, Windows, Linux, and Mac OS X.
  • ZX-Spectrum 48K, Plus/64K, 128K, Plus2 and Plus3 models
  • Assembler RACE/FACE Z80 core
  • Joystick emulated: Kempston, Sinclair1, Sinclair2 and Cursor joystick
  • Filemanager with subdirectories access
  • SNA and Z80 snapshots support
  • ...
(Added 2006-08-28, 448 hits, more)
Search:

Tags

creativisionpandorajswboulder dashuae4allx68000retrodevdebuggerdottatari800convertergamebasefcemega manconvertersid softwaremapsflyersscidownloadlost sourceapogeesegareplicascomposersgremlinquasi88infonesarticlewinampwalkthroughappleplus/4ngprpgnsftaitongcdbloglittle johnmsxmaemococosgbnintendo3docolemabc80ff7shmupsclubgp2xcamputers lynxgeocitiessoundtrackswolfenstein 3dopengldemo scenewiinetworkingflashnewsletterspcwto8italyendingsscorpionsolarispc-fxaquariusartworkonlineenginen64magazinechronologyrom hacksmailing listabandonwareseriesasciiartsunoscartridgesmerchandisezophargiana sistersz80librarypluginvic-20passwordsrecompilerconversionportfellowwindows cecodedemoatari 8-bitfdsassemblercommodoresidelitehpsf-7000usenetti-92p2000roms6502computerguideinterpreternet yarozegame designinfocomosf/1biosngpctrs-80dnaintroductionincompletefan fictionmulemac osmo6c128psionjavabasicsc-3000fm-7demossnatcherjeff mintertoolssnes9xmac plusindiana jonesinterviewssmalltandycheatsphotosguidescompiler32xjrpgsfpgaatari stefrododtvddrvcspcsxscansx86zx81biographybeebmodsfan artshoparchimedescomputingtutorialunixgame boy65816pom1xm6apple 2commercialxgspspcapcomprogrammingmagnetic scrollscomicszx spectrumcpodcastebaydownloadskigbgraphicspetatomopen sourcecharactersamigaarchivedithistorypsfcoverscompatibilityti-89sdkspritessmartphonemonkey islandunmaintainedfaqsarcadeastrocadevbametal gearfusemarat fayzullinaixwikipediaarnoldclonesfanzinevicefolkloreemulatorsapple 2gsstrategythomfujitsudatasheetsrom hackimagesftpfm townsmacmidiwalkthroughsmupenj2meralph baertvtoolaltairencyclopediax1namcomaniac mansionspace invadersfpceatari 5200academicllamasoftrottflashcartsxboxvectrexron gilbertwinuaekim-1musiccensorshippowerpcuaedma designsimcoupescummdragononline playgame geardoombbc basicandroidhucvisual basicscreenshotsgrim fandangobabycollectionnescp/mpc98mark3remakessoundsnkmega drivegp2xpectrumhitchhikerarstechnicamanualshardwaremike daillytoshiya takedamagazinesosxarcadiaatarifinal fantasyhandheldplayerslinuxamstradoricps2agifreebsdsquaresoftsymbianstudio 2palmostrailblazersaturnibmradiocharles macdonaldvirtual boygamehandytnkstreamingbbcidepointlesscasioxm7mo5calculatorpdfphilipsfmsxdocsmastergearjapanhomepagelisastelladarcnesrick dangerousgamecubefinal burnnvgsupervisioncatalogsoftwareiosukacorntype-inodyssey2castawaymartin korthcopiersrainbowremakehereticmarcel de kogelsonicinterpretersmp3pc enginebox shotsbluemsxfan gamesfrontiercomputersanalysispc-88mediatechnoteslynxformatsshmupadamkegsgplsega cdwizqlarchivemipswikilinksintellivisionremixescpurom hackinggccsmsbard's talems-dosunreleasedc64scummvmdumpinggamesmessvideosssemconsolescivilizationadventure gamesik+neo geoz-codewscgermanydescentbo zimmermancd-ipokespocketpcadsharvestos/2cd32richard bannistersovietgp32necbeoscps2epsonibm pcoperating systemiac16solutionsresourcestcp/ipvideo gamesapple 1pc-98patcheszx80windows8-bitvaxultimacommander keenspecspsxdosboxsdldreamcastcompilationsjapanesespainsinclairgallerygifvideojaguarfrenchpentagonemulatorchip8referenceauctionstoshibahead over heelstutorialsthalionmz-800toslucasartsgizmondorom listingspreservationrpgstimelinecopy protectiondatabaseversionsddjpaul robsonmtxsam coupĂ©masterndsreviewsmanualpublisherboycott advancekonamiarticlesarmjumpmanti-99/4aspectravideohumornewsexcerptstoryforummaking ofqnxpasopiaatari stgbaluxorcolecovisionpeopleunderdogsneopocottsierragermanpinoutsdavid foxmastertronicto7source codeascii artgbcnewsletterjum52olafneshintsbugsfranceinstallersschematicsdingoo3d realmsquotesbooknesterneopopgnuboypv-1000duke nukemzorkifrzxcpcsonyfirmwarecaanooemulationdiskmagsbenj edwardsfamtasiahugues johnsonsms plussharptgemuzaurusmz-80compressionhexen.nettranslationsi18nfpsevgbcolumnsgithubmamemz-700faqgenesis pluscompetitionjrpgatari 7800basicnescollectingcartridgeedgeinterviewpiratesadventure gamescott adamsteoshareware68kgradiusaction replaymuseumneo4allusfeaturesfcmultifacedelphitoolchainculturemoviesjupiter acerisc oselectrongeneratorxzxcreatorsbookspc-6000triviayoutubehi-scoresgamasutrawonderswansg-1000magickitspace quest