visual basic

link thumbnail basicNES 2000
NES emulator for Windows written in Visual BASIC. Source code is available and has served as the basis for several other NES emulators.
[Files have been archived.]
(Added 2006-11-17, 482 hits, more)
link thumbnail HyNES
NES emulator for Windows written in Visual BASIC.
(Added 2006-11-22, 326 hits, more)
link thumbnail LissNES
NES emulator for Windows written in Visual BASIC.
[Downloads have not been archived, and I have been unable to track down the source code. Binary at Zophar's Domain.]
(Added 2006-11-22, 308 hits, more)
link thumbnail MarioNES/80five
NES emulator for Windows written in Visual BASIC.
(Added 2006-11-21, 212 hits, more)
link thumbnail olafnes
NES emulator for Windows written in Visual BASIC and based on basicnes 2000.
olafnes is an enhanced unofficial continuation of the basicnes 2000 project (as of version 1.5 [debug level 1]), a nintendo entertainment system emulator by don jarrett, david finch, and tobias strömstedt.
(Added 2006-11-24, 501 hits, more)
link thumbnail Olafnes Rebuild
NES emulator based on olafnes, which is based on basicnes 2000.
based on olafnes v0.2.1,instead the codename "RC".design for Chinese Famicom Compatible Machine call it "Xiao Ba Wang".
Er, yes.
(Added 2007-10-30, 235 hits, more)
link thumbnail VB64
Commodore 64 emulator written in Visual BASIC.
I chose to write an emulator in VisualBasic as a technical experiment into the power of VB.
(Added 2007-01-30, 252 hits, more)
Search:

Tags

quotesauctionspeoplemanualsgccgbamac os3d realmsddjrom listingsjumpmancataloggnuboyplus/4mipsdottcasiosnatchertrailblazerrom hackcopy protectionmz-700mp3japannamcoremakesmike daillyzx81computingrick dangerousmesspandoragamecubeacademicfinal fantasyjum52unmaintainedcreatorsbasicnescompilermtxosf/1infonescommander keenrzxfan fictioniostutorialbiosfellowbard's talecolumnscompetitionfpcedatasheetsnvgvaxformatssfcngpcremakeharvestmaniac mansionpdfspace invadersopen sourcesf-7000compatibilityvideopublisherkim-1darcnesluxorrainbowmacadamsonyhandheldflashcartsinterviewssidintellivisiongermanmodssmsbasicsquaresoftfpgacharactersbeebn64geocitiessgbmidisymbiansaturnspecsindiana jonesgamehandysegagenesis plusebayspaindatabasescummopenglmaking ofqnxtoolversionshugues johnsonibmc128lucasartstvjrpgtutorials8-bitqlgp2xpreservationneo geocapcomtimelinedreamcastreferencepiratescomputersvideo gamescivilizationfceunixscipc98composersmupenapple 2gsreplicasralph baerdemoatari 8-bitsdlfrontiercastawayvcsagi.nettandypv-1000streamingwolfenstein 3dddrtgemufirmwarefaqslisaxzxandroidsdkcopiersboulder dashcolemdemostoshiya takedacommercialllamasoftcultureneopocottxgsbluemsxunreleasedzx spectrumngpto8passwordsatomjaguarhintsdtvfamtasiapcsxgp2xpectrumuaecpctcp/ipgradiusgizmondocreativisionarstechnicahistoryz-codeencyclopediaitalyvbatosmac plustype-ingrim fandangotrs-80supervisiongiana sistersrpgssam coupéti-92downloadsarticlesource codeto7snes9xrisc osserieshead over heelspc-88ps2excerptapple 2rottthompentagonsharphucscreenshotsidechronologypinoutsarcadiagifspritescaanoosinclairfm townsgplmarat fayzullinzx80archivecartridgesnintendoamstradfan artresourcesconversionpsionpowerpccomicsgraphicsfan gamesflashadsvideosron gilbertintroductionadventure gamewikipediawindowsfpsedragononlineepsonjapanesejeff minterpc-6000abandonwarepom1winampelectronblogpodcastpcwpc enginex86adventure gamesamigaprogrammingscansboycott advancekonamibiographybugsphilipsastrocade6502frenchrpgconvertershmupfujitsuvicex1xm7spectravideomagazinesgamescommodorecalculatorshmupsatari 7800chip8hardwarearcaderom hackswonderswanmastergearsonicwindows ceradioduke nukemmedianeo4allarticlesgermanymoviesnewslettersnewsmuseumpluginatari800edgelost sourcemartin korthinterpretermastercps2collectiongallerycomputerwizdoomgbcdiskmagsmanualcartridgepocketpc65816maemomonkey islandpalmosflyersti-89scott adamsarmphotosbox shotsvgbarnoldx68000engineascii artunderdogstranslationscoversasciiartgamebaselinuxssemsmartphonegremlinlittle johnwalkthroughscolecovisionbooksmark3walkthroughpointlessmuleodyssey232xmapssmallitdnanecff7iagithubstudio 2mega drivemz-80abc80toolchainappleaction replayj2mecollectingz80fmsxvectrexplayersimagesdemo scenecocokigbcompressionxboxyoutuberomsdingoopspschematicsjupiter acepasopiataitoremixesik+technotesmetal gearsovietgamasutraacornnesartworknet yarozectoshibastrategymultifaceconsolesinstallersrecompilerpc-fxsolarishitchhikerteomo5psxc64sc-3000assemblerendingspsfaquariusquasi88frodosharewarewiic16fanzinepatcheswscportwinuaeosxsierrabbc basicdma designxm6sg-1000charles macdonaldmagazinemamehumorinterviewstorysunoscd32snkbabysolutionsguidesthalionscorpionsoftwareelitemo6pc-98operating systemreviewsfeatureatari stebookcd-iatari 5200mega manneopopmagickitsms plusbo zimmermanfinal burnmailing listtnkanalysisatari stjrpgsmastertroniczopharzorkmusicgame geardumpinghi-scoresfolklorengcdforumonline playcamputers lynxatarijswvisual basici18nfm-7scummvmkegspokescpuultimacompilationsuae4allbeosretrodevmsxos/2space questmz-800codeuklynxoricfdsti-99/4asega cdhpsimcoupeusemulationdocsfranceemulatorzaurusmarcel de kogeldebuggertoolsvirtual boyinfocomifdescentapple 1generatorlinkscheatsinterpreterssoundtracksms-doscensorshipstellaguidehomepageapogeelibrarypetmerchandisefaqnetworkingrom hackingnsf3doarchimedesgame boyarchivedvic-20game designdelphigp32david foxbbcdownloadid softwareftpshopsounddosboxtriviaincompleteemulators68kfusenewsletterhereticndscp/mibm pcrichard bannisterconvertersbenj edwardsolafnesclubusenetjavaaltairpaul robsonmagnetic scrollscloneshexennesterfreebsdwikiaixp2000