visual basic

link thumbnail basicNES 2000
NES emulator for Windows written in Visual BASIC. Source code is available and has served as the basis for several other NES emulators.
[Files have been archived.]
(Added 2006-11-17, 617 hits, more)
link thumbnail HyNES
NES emulator for Windows written in Visual BASIC.
(Added 2006-11-22, 446 hits, more)
link thumbnail LissNES
NES emulator for Windows written in Visual BASIC.
[Downloads have not been archived, and I have been unable to track down the source code. Binary at Zophar's Domain.]
(Added 2006-11-22, 449 hits, more)
link thumbnail MarioNES/80five
NES emulator for Windows written in Visual BASIC.
(Added 2006-11-21, 332 hits, more)
link thumbnail olafnes
NES emulator for Windows written in Visual BASIC and based on basicnes 2000.
olafnes is an enhanced unofficial continuation of the basicnes 2000 project (as of version 1.5 [debug level 1]), a nintendo entertainment system emulator by don jarrett, david finch, and tobias strömstedt.
(Added 2006-11-24, 620 hits, more)
link thumbnail Olafnes Rebuild
NES emulator based on olafnes, which is based on basicnes 2000.
based on olafnes v0.2.1,instead the codename "RC".design for Chinese Famicom Compatible Machine call it "Xiao Ba Wang".
Er, yes.
(Added 2007-10-30, 354 hits, more)
link thumbnail VB64
Commodore 64 emulator written in Visual BASIC.
I chose to write an emulator in VisualBasic as a technical experiment into the power of VB.
(Added 2007-01-30, 370 hits, more)
Search:

Tags

video gamesastrocadefpgapaul robsonsolarissnkzx80japanebaytoolabc80gamesgp2xqlgeneratordma designtandyfujitsuscott adamssgbquotesmastergearacornpv-1000net yarozegiftrs-80gameedgetnkemulatorssam coupéclubvisual basicpsx68kshopgp2xpectrumscummarnoldpodcastmz-80jeff minterluxorgenesis plushpmonkey islandstellawiiretrodevmidicamputers lynxsmsdarcnescopierslibrarysnatcher3d realmszopharcd-ichronologyatari 7800civilizationdnanecstrategyti-92multifacebo zimmermanstoryarcademipswinuaedownloadexcerptmtx8-bitscummvmsdldragonpointlessspecsquasi88cps2videosarcadiagrim fandangoradiokigbmike daillyti-99/4asoundsonyn64neopocottvectrexabandonwaremaemopc98game gearphilipsprogrammingendingsjrpgx86analysisgizmondocharles macdonaldascii artnesterconversionreplicaswindows cefrododescenthead over heelscodefan artpinoutscartridgespc enginepalmossierramaking ofibmandroidatomcreatorsrpgselitestreamingc16dumpingmessx1cmagickitgbacommodoreremakemega manopenglps2emulatortutorialmarcel de kogeljupiter acemamenewslettersi18nz-codeincompletenetworkingshmuppiratessupervisionngprom hackscomputingpcsxdocstrailblazerenginenewsletterfreebsdartworkvaxinterpretersbbc basicsega cdxm7tgemuwsclittle johnmupennesjum52historyzorkzaurusuaegnuboysovietarticlescasiolynxitx68000ik+spainj2meromsindiana jonestype-infan fictionresourcescolemcharactersencyclopediamuseumpentagonhitchhikersharewareagiscreenshotsstudio 2atari 8-bitcensorshipintellivisionfinal fantasybasicfinal burnbluemsxplayersngpcversionsspritestvpokespluginultimapatchesneo geomac pluscheatsdatasheetsadventure gameidexm6olafnes3doddrgp32gamasutrainterviewgamecuberemakescalculatorpcwarchiverzxcaanootoshiya takedainstallersgeocitiesgithubsaturngradiusmsxfirmwaresinclairatari800ti-89taitofm townsaixboulder dashatari stdottshmupsreviewsscansadsibm pcmartin korthrom hackingzx81photosmagnetic scrollsvirtual boysharpftppsfapplehintsrisc oscp/mgermanyfolklorerick dangerousonlinesonicmega driverom listingsassemblernamcofdslisandswinampasciiartwolfenstein 3dmetal gearscorpionpreservationauctionssdkosf/1ngcdp2000amstradpsionatari 5200sf-7000academichexenportgiana sistersclonespocketpcpasopiademobloguae4allto7apple 1imagesneo4allkim-1consolesfuseformatscd32jrpgspom1computercomposerssg-1000publisherosxbooksunosfamtasiajapanesewikipediagame designinterviewshandheldron gilbertmoviescartridgeos/2comicscommercialgame boycpuiacolumnscompilationsrottoricmz-800faqmac osgplarstechnicaduke nukemspace invaderscopy protectioncollectionlinuxvbamo5graphicscreativisiondingookonamiguideid softwarepandoragermanguidesgremlinwikiatari stecoverswalkthroughshardwarefpcecollectingsmartphoneitalyrpgamigahugues johnsonbeosrecompileropen sourcemark3mulesms plusfellowwalkthroughtossource codefrancecolecovisionyoutubehumorapogeeodyssey2fcebabysymbiantoshibaspectravideoxgs65816mediaflyerscompressionfaqssfcinterpreterlucasartsmanualforumdelphiusenetpc-fxtechnotespetapple 2gsinfocomdebuggerflashcartsaction replayspace questheretictcp/ipdemosfanzineteocastawaymodsemulationdatabasefrontierlinksfmsxrainbowmailing listarmkegsthomconverterhucwizcomputersdoomaquariussciserieschip8magazinecompetitionbiospspbard's taleplus/4biographyvgbjumpmanbookssolutionsboycott advancearchimedesdavid foxsegaunixatarisoundtracksssemtutorialsvideosmallcpcbeebcompatibilitysc-3000downloads32xapple 2musicpc-88dreamcastschematicsrichard bannisterintroductionbugssidcatalogmaniac mansionharvestvic-20jswpc-6000ms-dosfpseneopoppdfto8box shotsdosboxgalleryqnxreference6502iosjavamapsgbcmo6nvggamebasehomepagexboxzx spectrumfan gamesarticleunderdogstoolsddjfm-7hi-scoresadamsoftwareepsonc64viceoperating systemgccconvertersmarat fayzullinunmaintainedcapcomelectronarchivedmp3featurewonderswanbenj edwardsvcstoolchainremixessquaresofttimelinelost sourcewindowsthalionc128nintendoxzxbasicnesmaccocojaguarpeoplellamasoftaltairralph baerflashadventure gamesmasterbbcdemo sceneff7powerpcz80nsfsimcouperom hackustranslationsmanualscompilermerchandisehandytriviainfonesdiskmagsmastertronicpasswordsonline playunreleasedmz-700ifcommander keenculturemagazines.netpc-98uknewsfrenchdtvsnes9x