unmaintained

1 2 3 4 5 6 >   Next Page >>
link thumbnail FCE cool enja
Incomplete open-source NES emulator for DOS that served as the basis for many other NES emulators.
Why I make NES emulator where many many emulator are available? I want to port NES emulator to PlayStation,but I can't find Portable C source except xNes,it is too slow for PS on R3000/33Mhz. so now I'm making NES emu for DOS/VGA first. My last target is PlayStation with portable code, s ...
(Added 2006-11-21, 419 hits, more)
link thumbnail Pete's Domain hot
Home of several excellent (and unmaintained) plugins for PlayStation emulators.
(Added 2003-11-12, 1020 hits, more)
link thumbnail AC64E - Axel's C64 Emulator
Alpha-quality C64 emulator for .NET. Source code available.
AC64E simply means Axel C64 Emulator and represents an other C64 emulator.

I'm working on this little tool since 06/2003 - and compared to other emulators out there it is still a really buggy Alpha version ... and it will remain in this state for ever ;-)
(Added 2006-08-11, 391 hits, more)
link thumbnail Acorn AdamEm Homepage
This is a port of Marcel de Kogel's excellent Coleco Adam emulator. It is more advanced than ColEm in that the Adam is a fully fledged computer, and it emulates the Colecovision. However this port is fairly basic atm. It will shortly be in a state that will make it comparable to the port of ColEm.
(Added 2012-10-08, 212 hits, more)
link thumbnail Acorn Atari800 Homepage
This is a port of probably the best and most complete Atari 800 emulator out there. It not only emulates the 800, but also the 800XL, 130XE and the 5200. If you are into retro Atari stuff this is pure heaven!
(Added 2012-10-08, 219 hits, more)
link thumbnail Acorn ColEm Homepage
This is a port of Marat Fayzullin's Coleco emulator. This was my first emulator port and it has improved over the months. It is now very stable, fully configurable and is becoming the benchmark by which all my other ports have to live up to.
(Added 2012-10-08, 210 hits, more)
link thumbnail Acorn DarcNES Homepage
This is a port of the nice multi-system emulator DarcNES. It doesn't stretch itself too far and emulates just a handful of systems and it emulates most of the pretty darn well! The NES emulation is excellent and has sound!
(Added 2012-10-08, 261 hits, more)
link thumbnail Acorn DGen Homepage
This is a port of the excellent DGen, which is by Dave - author of many top emulators... check out Final Burn especially if you like Power Drift and have a PC to hand. DGen emulates the Megadrive and does so pretty well. However the Acorn platform and the emulation of a 68k processor do not go hand in hand without a lot of work, and for this reason DGen is slow... you will need an SA m ...
(Added 2012-10-08, 212 hits, more)
link thumbnail Acorn fMSX Homepage
This is a port of Marat Fayzullin's MSX emulator. This is an emulator of the still fairly popular, among a strange set of enthusiats!! (I suppse the same could be said of Acorn enthusaists), MSX computer range. It emulates the MSX, MSX2 & the MSX2+. The Acorn version contains the ROMS needed to emulate these machines.
(Added 2012-10-08, 247 hits, more)
link thumbnail Acorn Generator Homepage
This is a port of Generator a nicely developing Megadrive emulator. Even with the tricks employed within the cpu core the emulation is slow. The port has sound though and provides a nice alternative to DGen. The choice of which you use is completely yours, but if you don't have a StrongARM there is little point in bothering, unless you have a *lot* of patience.
(Added 2012-10-08, 227 hits, more)
link thumbnail Acorn Handy Homepage
This is a port of the only Atari Lynx emulator out there. The emulator runs almost everything you can throw at it. This current Acorn release is quite old and really needs to be put in sync with the current Windows version. However it does run most games well enough.
(Added 2012-10-08, 214 hits, more)
link thumbnail Acorn HuGo Homepage
This is a port of one of the best PC Engine emulators out there. It runs most things you can throw at it. Unfortunately this Acorn version is way begind the Winodws release. I'll bring it into sync once I have sorted out a few issues with CD emulation, that have been giving me trouble.
(Added 2012-10-08, 229 hits, more)
link thumbnail Acorn MGear Homepage
This is a port of Marat Fayzullin's Master Gear emulator. This emulates both a Master System and a Game Gear.
(Added 2012-10-08, 224 hits, more)
link thumbnail Acorn Minus4
This is a port of Minus4 a Commodore +4 emulator. The Commodore +4 was a strange machine. It was meant to be a business machine, however never really suceeded. Like the MSX it could have disks,tapes and cartridges. It was one of those machines that if you used one or knew someone that had one it would stick in the mind... For me I had one for a few years and I remember playing Trailbla ...
(Added 2012-10-08, 179 hits, more)
link thumbnail Acorn NeoPocott Homepage
This is a port of the only Neo Geo Pocket emulator that is currently under development. Things are being updated very readily and by the next release even more games will be playable. This current release runs at full speed on an SA powered machine, lower specced machines will definately be at a disadvantage. Hopefully speed will improve yet further. Memory usage is around 6MB for the ...
(Added 2012-10-08, 193 hits, more)
1 2 3 4 5 6 >   Next Page >>
Search:

Tags

dottspace invadersngcdtoshiya takedaiflynxcopy protectiondatasheetsretrodevmulegermancaanooincompletemastergearjupiter acesharphistoryjrpgsmtxinterviewscartridgesaturnclonesvbalittle johnmagickitappleresourcesrichard bannisterwonderswanpentagonmapsvirtual boyhi-scoresascii artnesterfrontierolafnescolecovisiontoscapcomvcsamstradscigamasutraconverterusenetmo6interpretergccddrscummbo zimmermankim-1darcneselectronfamtasiaboycott advancegiana sistersx68000rick dangerousfeatureemulationbbcmasterarchimedesbiographyfujitsuibm pcsunositastrocadegraphicstriviainstallersmz-800analysisflashcartsfdsduke nukemgamesromsuae4allnintendoelitecd-ifaqspspzaurusreviewsto8solarisdingoocartridgesadventure gamesrecompilerjaguarcalculator3dogrim fandangogbamamegame gearmagazinespokesfinal burnfellowblogmupenralph baerpalmosgenesis pluscpcculturejapaneseyoutubeforumgradiusdocsgnuboycompetitionnewsletterguidetoolsbasiccasiosnkcheatscommercialfmsxchip8apogeegeneratorfinal fantasyatari 7800armpv-1000gbckonamipom1firmwaregeocitiesunixsdktoolchainsoundtranslationsarcadiaxgsgremlinmetal gearwiiartworksmstimelinebox shotsxm7epsonvgbprogrammingik+arcadealtairmz-80fanzinesymbianto7pasopiamagazinecoverspeoplesmartphoneddjvic-20seriesrom hackingmark3pc-98shop.netdtvsonytnkmaking ofaquariusmastertronicdnashmupsviceacornpiratescodeqlmac ospaul robsonformatsmike daillypc98scott adamsatari 8-bitspace questconversiondavid foxcps2comicshandheldmz-700marcel de kogelwalkthroughsiosmega driveti-92archivedclubpointlessosf/1neopoppcsxps2rom hackssega cdquasi88sms plustvmanualsgalleryzx81c64collectionmarat fayzullintype-inpc-88fan artopen sourcemagnetic scrollsdiskmagsreferenceamigadatabaseportcamputers lynxcreatorsconsolesspritesoricultimaharvestfpganeo4allnetworkingrainbowsharewarehintsmerchandisefpsemega manendingspandorax86podcastsnes9xcomputerspreservationfrenchcompilationsjeff mintercollectingcpusonicatariarticleaction replayftpwinuaewikigp2x8-bitcreativisionpdfadamatari steti-99/4ajapanmo5specsosxrom hackcensorshiphomepagewalkthroughwscxm6atari stpc-6000msxpsxwizzopharngpcz-codearstechnicaneo geoindiana joneshardwarexboxunmaintainedmp3vectrexcatalogdemoscommodorehandyibmbiosnsfitalytutorialsuksupervisionscummvmonlinepc-fxj2mearnoldpocketpcuaetoolwolfenstein 3dtechnotesthomdosboxzx80mediarottpetid softwarewindows cep2000studio 2modsremixes65816net yarozephotosbbc basicandroidcolememulatorkigbrisc os3d realmssimcoupegiftaitoneopocottunderdogsadventure gamekegssam coupĂ©publisheradscommander keenreplicasencyclopediahexenunreleasedfaqstellahumorplus/4tgemuspainscorpionhereticmultifacesdlatari 5200messinfonesbard's talehead over heelsdebuggerscreenshotsfrodoapple 2gsn64descentmusictrs-80basicnes68kvideosndsgame boyvideowinampsierraasciiartbeoscompatibilitygamebasetandyebaycd32scanscivilizationfreebsdjum52librarysnatcherron gilberttrailblazerlucasartslinuxremakesdoomsmallqnxinterpreters32xplugincompressionfpcepowerpcschematicsbluemsxhugues johnsonsolutionsx1c128thalionfcehpfuseauctionsimagesnewspasswordsngpvaxapple 1abandonwareinfocomversionsdelphifolklorestorycomputinggithubcopiersbabyarticlesflashmipsnvgoperating systemtcp/ipmac pluscharacterssoftwarejrpgabc80newslettersgizmondovideo gamesintroductionradioos/26502atari800i18nmanualmonkey islandmaniac mansioniasf-7000idesource codenessg-1000pc engineteointellivisionjavaphilipsneczx spectrumplayersinterviewfm townssinclairlost sourcejumpmanpsionsovietremakemartin korthtutorialacademiccocobookstrategysquaresoftfan fictionwindowsff7zorkatomagiquotesbookssc-3000gp2xpectrumapple 2namcoshmupgplhitchhikermoviesllamasoftfan gamesmuseumonline playluxorz80converterssoundtracksassemblerrpgsdownloadssfcsidxzxcolumnsemulatorsmacbenj edwardsgamecubelisaarchiveaixguideshucrzxcenginepcwexcerptdragoncomputerrom listingsti-89charles macdonaldtoshibamidisegams-dosgp32wikipediarpgpsfgermanylinksmaemocastawaycomposersedgeusdemofm-7visual basicdma designdreamcastchronologybeebdumpingssempatchesboulder dashcp/mgame designspectravideocompilerjswopenglodyssey2flyersgamec16sgbstreamingdownloadfrancemailing listdemo scenebugspinouts