taito

link thumbnail RAINE
Multi-machine emulator focused on Taito and Jaleco games.
(Added 2003-11-12, 516 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 459 hits, more)
Search:

Tags

charles macdonalddtvgeocitiesms-dosmesshi-scoresinterpreterllamasoftmameidehomepagemsxaltairddrspace questhead over heelspcwmz-800javamac plusuaerpgsplayerslynxinterviewhintsdemoretrodevscummvmcartridgeszx81arstechnicajswcalculatorstoryonlineclubmarcel de kogelto7comicsthalionibmwalkthroughsapple 2gstoolatari800sonichandypublisherzx spectrumchip8lucasartsik+ukmaemotutorialsapogeeftpdiskmagsshmupsdemo scenepspresourcesimagessms plusmusicdebuggermipsifbiosralph baerdumpingclonestrivianewsz-codetype-inascii artapplecreatorsfreebsdcastawaymagazineblogandroiddma designcd32cartridgecompilationspentagonibm pcversionswinuaerick dangerousc16referenceneopocott.netnsfindiana jonesdescentmz-700compatibilityconvertermac osgnuboybookdreamcastcpusidmanualssnk8-bitmaniac mansionarmcolembabyrpgmupenconversionsgbsmshexenpc engineaquariusmastergearfan gamescommodoremuseumremixesatari 5200rzxiosjrpgssoundxm6youtubewscbbcultimasquaresoftoperating systemmagickitusenetmega manquotesmanuallittle johnbox shotspc98supervisionabandonwaretosmoviestranslationsfinal burnsc-3000excerptshmupatari 8-bitto8midimarat fayzullingenesis plusbasicnesdatasheetsteoinfocomneo4allatari 7800recompilerscorpionx1commander keencharactersmega driverom listingsmailing listflashcartshumoremulatormerchandiseenginebiographyinterpretersintellivisionrisc ossegaatarisierraremakespasswordsnescps2masterndsxm7qnxfcecolumnsforumcataloghuckim-1incompletetoolsdownloadsprogrammingcolecovision3doxgsmultifacemaking ofstreamingrom hackingzopharzx80frenchreplicaspocketpcbenj edwardsremakenewslettersbbc basicjrpgpv-1000solarisarnoldwikiwinamptandynet yarozearcadesimcoupecopy protectionscott adamstimelinesovietitalyzauruscoverstrailblazeremulationpandoraunixddjrichard bannisterunderdogssg-1000archivefanzinevideoromsacademicreviewssource codecamputers lynxcomputersos/2nintendoadsarticlesamigac64darcnesatari stpc-88macngcdosf/1wizjapancultureps2mulejum52lost sourcegamasutrafinal fantasycd-ibeossunosarticleasciiartjumpmaninterviewsflashdatabasemediacommercialwindowssega cdgallerydragonconsolesgame boyformatstcp/ipspritespdfcp/mthomx68000amstradbooksusgradiuspasopiaaixcheatsseriespalmosstudio 2fpcecivilizationwiicompetitionhardwarez80sfcgbaarchimedesx86japanesepom1mtxitgifuae4allpc-fxsnatchercollectionconvertersgeneratorsam coupĂ©mapsmonkey islandj2meagicasioti-92neo geoc12832xadamssemanalysisphilipswikipediapc-98elitecensorshipvicedownloadcpcsdksolutionsn64hitchhikerolafnescaanoodelphicocop2000copiersencyclopediacwolfenstein 3dopenglhereticsoundtracksi18nscipirates6502portvbagithubendingspeoplesharpinfonesti-89gamebasegp32fellowquasi88vectrexgraphicscodegermanypsfscummarcadiamo6screenshotsmagnetic scrollsxboxbeebboulder dashmark3mo5assemblergamespc-6000game designpokesnamcolinksfm townssonybo zimmermanqlspectravideooricvic-20artworkfamtasiarom hackron gilbertcomputerjeff minterphotosdemosopen sourcehistorykonamitaitofm-7technotesgame gearvcs65816compressiongremlinbluemsxfmsxplus/4installersmp3video gamespsionpodcastvirtual boyfolklorepointlesspowerpcsymbianfaqsvaxdosbox3d realmsemulatorsmartin korthid softwareiavideosintroductionstrategyapple 1collectingpcsxadventure gamesluxorxzxgbcbasicvgbpatchesadventure gameguidesvisual basicgamehandheldnetworkingnecfdsfujitsucompilerfrontierff7smartphonelibrarybard's taleaction replayfrancesdlcomposersfeatureduke nukemmastertronicpsxfan artsmallneopopmetal gearspecsnesterspace invaderscapcomboycott advanceedgegamecubemagazinestvfan fictiongermandocsjaguarrom hacksstellangphptnkscansgccgrim fandangoti-99/4atutorialnvgdingoofusezorkkigbjupiter aceelectrontrs-80epsonpluginabc80david foxatompreservationshopspainrainbowonline playsharewarefpseflyersgp2xpectrumcreativisionpettoshibacomputingfaqgpldnahugues johnsonsaturngiana sistersmodspinoutsunmaintainedsf-7000frodokegsapple 2sinclairdottngpc68kgizmondoarchivedradiowalkthroughtoolchaintoshiya takedaebaymike daillywonderswanguidemz-80windows cedoomfpgalisaosxastrocadegp2xfirmwarelinuxchronologypaul robsonunreleasedacornharvestschematicsbugstgemusoftwareodyssey2snes9xnewsletterrottatari steauctions