taito

link thumbnail RAINE
Multi-machine emulator focused on Taito and Jaleco games.
(Added 2003-11-12, 543 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 490 hits, more)
Search:

Tags

x68000frontiernet yarozeosf/1featurescicd32tnkpokesnewsletterpdfversionshomepagesc-3000strategyjavahitchhikerhandheldarchivevicescorpionvirtual boymamepspzx spectrumvideo gameshugues johnsonpatchesti-89ddjmaemounderdogspasswordshereticmusicpcsxgp32apple 2gsuswinuaebbccommander keentoshiya takedacollectiongbcmo6mega drivezophargamecubehumorstellacolemboycott advanceboulder dashmanualfrancejum52symbianmtxdottatari steff7osxx1basicnesremixesquotesapogeeps2cartridgerom hackagiemulatorspc-88oricbiographyengineto7mo5marat fayzullintrs-80bard's talerichard bannisterpreservationtranslationsxgspandoramastertronicsega cdi18ncolumnsexcerptrecompilergp2xxzxralph baersonyftpvbafreebsdmac plusonline playpsfgradiusdma designdemo scenesquaresoftmaczx81tutorialfinal burnnamcocamputers lynxopenglmagickitmediaibmtimelineflashcartsmz-80fceluxorfan artdemoscolecovisioniagremlinbeoslibrarypinoutsmastergeartaitomailing listfan fictionunmaintainedcollectingdtvaction replaydatasheetsmagnetic scrollsshmupadsjapanwizadventure gamesvaxhead over heelssegaarnoldmarcel de kogelwikijeff minterconverterspowerpcmaniac mansionmidingpcretrodevpluginibm pcgccsidlinksepsonvideotrailblazerasciiartcharles macdonaldshmupsanalysisspace invadershucschematicsbabyaltairmagazineitpsxsfcron gilbertsolarisgeocitiesatominstallersseriestechnotesnecrisc osdiskmagsmaking ofsupervisionjrpgtoolsoundtracksrottmanualsgnuboynsfreplicasx86demoultimazx80bo zimmermanmessdingooscummvmfuseneo geosdlapple 1interviewfan gamesradiolynxpasopiaunreleasednintendocastawayfolklorebeebwsciosgithubadventure gametriviaitalycommodoreto8game designsg-1000c128romsmasterformatsgifpaul robsoncwiismartphoneifvcssharpacornxm7linuxcps2museumassemblerlost sourcejaguarvectrexmapscomputersportmetal gearpc-98descentrick dangerousintroductionwinamparcadiapsionsovietinfonespc enginehintsmike daillyjrpgsmz-800referencenewslettersremakedocsc64fm-7fellow32xvic-20tutorialsencyclopediavideostgemumz-700copiersvgbcharactersapple 2playerssmstosmark3archivedcartridgeskonamigamasutrabooksthalionacademic8-bitrom hackscomputing6502podcastfaqsamigadarcnesconsolesscreenshotsz-codearticlegamemultifacewonderswanmega mansource codebluemsxforumconvertermipstype-induke nukempocketpcascii artgame gearstreamingatari800codecompressionneo4alloperating systemremakesfujitsucoverscapcomrzxdosboxtoolchaingame boyabc80articlessimcoupellamasoftdownloadsspainmonkey islandsnatcherfirmwaremac osguidesimagespetfanzinepc-6000windows ceyoutubedragondumpingguideodyssey2bbc basicincompletemartin korthsmallinfocomplus/4sunosastrocadeti-99/4acivilizationhistoryz80culturegamebaseunixresourcessaturnnvgsinclairrom listingsmsxpentagonarstechnicasnkti-92gizmondocomposersgermanyabandonwarerom hackinggenesis plusxboxxm6adamik+walkthroughscompilermupensounduknesteratari 8-bitdreamcastappleatari stwindows65816kim-1compatibilityemulatornewscasiopointlesskigbn64space questmoviescheatsaquariusquasi88bookndsfrodopalmoshardwarescummpc98publishernetworkingsam coupĂ©graphicsfm townschip8sgbwolfenstein 3dcomicsphotosdebuggercomputerjumpmanedgeteofrenchcommercialqlcatalogsms plusid softwarejupiter aceartworkms-dosshopatari 5200toshibascott adamsddrcaanooendingsreviewscreativisionngcdchronologyrpgsphilipsgalleryandroidlisastoryzaurus68kcoconescpcusenetatari 7800mp3merchandisewalkthroughneopoparmpv-1000david foxclubdnadelphifinal fantasybiosuae4all3d realmsinterviewsgplgp2xpectrumcompetitiontoolscd-ineopocotthpinterpretersfmsxgeneratorintellivisionfdsebaydoom3doqnxfpcesharewaregiana sistersindiana jonesmulejswlittle johngbaj2mesierrahi-scoresscanscalculatorsdkdatabaseaixolafnesc16uaeos/2flyersideelitesnes9xgermancopy protectionelectronfaqpom1compilationsfpgahandyrpggamesatarifamtasiapcwpc-fxzorktandymodsinterpreterngplucasartsdownloadpeopleauctionsamstradopen sourcehexenbugscpuwikipedia.netjapanesearcadefpsegrim fandangop2000kegsbasicclonesharvestsoniconlineconversioncensorshipmagazinesssemsf-7000emulationtcp/ipcreatorstvbenj edwardsrainbowstudio 2blogarchimedescp/mpiratesthomflashspecsvisual basicspectravideobox shotsprogrammingsoftwaresolutionssprites