taito

link thumbnail RAINE
Multi-machine emulator focused on Taito and Jaleco games.
(Added 2003-11-12, 381 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 322 hits, more)
Search:

Tags

intellivisioncapcomemulationcd-isoftwarevideosrom listingslisaflyerscovershomepageitfrontiertranslationszorkmega mangermanyscicompressionyoutubehistorystreamingastrocadesharpgizmondoarchimedesnvgcpccreatorssnes9xto8osf/1trailblazergiftutorialsmagazinegamecubefpcesidwalkthroughiosfmsxcompilercolecovisionukgp32sc-3000space invadersdelphispecspreservationinfonesmz-800competition6502newstcp/ippc98unixmo6studio 2resourcesmz-80pirateszx spectrumapogeemagnetic scrollssolarisinterviewsinfocomboycott advanceonlinepasopiaspritesdemo scenemailing listdreamcasttechnoteswindows ce65816francethalionclubopen sourcetos.netintroductionarnolduaecompilationsgamecalculatorpdftoolneo4allx1fpseexcerptfellowtvopengltaitondsbioswiijupiter acepc-6000osxconsolessquaresoftolafnesbasicsoundmaccheatsbox shotstgemuinterpretersbabymsxcollectingcatalogmagickitpatchestrs-80reviewsteointerpreterngpcps2ti-99/4ahexengame gearcivilizationron gilbertapple 2databaseduke nukemsonyphilipsapple 2gsgeneratorlibraryads8-bitschematicsmodscompatibilitysfccomposersngcdnecsms plusstrategyatari 7800vbacd32xgs32xmuseumcartridgesgame boylost sourcepandoraifrick dangerousos/2agikim-13doharvestjswphotosgamesitalyfujitsunsfdemolucasartshead over heelscopiersrecompilervideolynxrottfusegenesis pluscp/msegafinal burnadventure gamesjum52indiana jonesftpfan arttandyneopocottarchivejavacodekigbodyssey2wikimp3c16space questxm6online playdnamaniac mansionbeosbeebabandonwareinstallersvirtual boylinksscansgithubatomcaanoogamasutracartridgepeopleprogrammingdosboxcopy protectionjrpgsendingscasiowolfenstein 3dhintsmipsrpgscommander keenboulder dashdownloadslittle johnarstechnicablogibmwsccomputerplayerssdlgiana sistersplugingermanmoviesneopopelitepc enginefpgahpwinampfaqsrpgsmallpsxscreenshotskonamidottremakehugues johnsonjeff minteredgesolutionsepsonmo5rainbownet yarozefolklorestellaatari 8-bitmulespainpodcastfirmwaregp2xpectrumchronologyrom hackscomicsformatsfamtasiaxm7pcwff7maemoi18nhitchhikerzx80smartphonebasicnesfinal fantasyhi-scoresgbcusacademicsoundtrackssupervisiondiskmagsconversionaction replayusenettnkmetal gearscummabc80encyclopediamike daillyatari stmastertronicllamasoftnestermupenbbc basicsonicversionsbluemsxemulatorsgallerysgbpokeszx81smsarticlesdebuggerx68000aquariusj2mearcadedumpingradiocreativisionadamtype-inarmflashcartsfrodobo zimmermanplus/4pointlessdownloadscorpionmidimamebugsunreleasedmega drivetrivianewsletterpsionrzxmanualpv-1000timelinemonkey islandseriesxzximagesc128cocosaturndescentgnuboyrom hackauctionstutorialsinclairpc-88pocketpcclonesdavid foxaixmaking ofgccquotescomputersreferencesovietflashfm-7neo geogbauae4alloricatari 5200columnscamputers lynxidefrenchfaqsnkmerchandisechip8censorshipps2xboxscott adamsdemosemulatorgamebaseultimamac pluspcsxdma designjrpgralph baerfdsatari800handhelddingoonamcopsfdatasheetsmanualsmessmac osatari steconverterelectrongp2xbard's taleasciiartsdkoperating systemfeaturesnatcherqlmediamartin korthddrqnxdarcnesguidesamigavcsbooksfcescummvmngpcunmaintainedhumornewslettersapplevic-20toshiya takedaunderdogsshopaltairshmuppasswordshandysymbianamstradrichard bannistermagazinesvgbarticlequasi88rom hackingvisual basicremakesebaysource codeculturesega cdnetworkingarchiveddocsti-92wikipediaascii artretrodevpc-98gplti-89to7wizpublisherapple 1bbcjumpmanibm pcluxortoshibareplicasvideo gamescommercialcollectionpetmasterssemmarat fayzullinpowerpctoolchaingrim fandangoc64zopharshmupsthommapslinuxcommodoresg-1000benj edwardsgeocitiesmz-700romsmastergearforumhucik+enginedtvadventure gamesimcoupesierrapc-fxbooksharewaresunoscharles macdonaldmark3vectrexn64ddjandroidcolemvicez-codenintendorisc osp2000atarines68kwonderswanincompletecpuartworkzaurusdoompom1portspectravideocharactersfm townscomputingwindowswalkthroughsfan fictionmultifaceguidehardwaremarcel de kogelcastawayhereticdragonpalmosjapaneseinterviewmtxgradiusarcadiax86vaxz80pspfanzinesam coupéjapan3d realmsacornfan gamesgremlinid softwarestorymusiccanalysisremixesgraphicsconvertersgame designpaul robsonassemblersf-7000freebsdpinoutsbiographyiatoolswinuaejaguarkegspentagonms-dos