space invaders

link thumbnail E++
E++ is a portable, OO emulator. It is designed to be flexible and easy to extend. The current version runs under DOS only. This version has Z80 and 6502 cores built in, and emulates the
following systems:
  • Sinclair ZX Spectrum - With sound through your sound card,
    and Kempston Joystick support.

  • Space Invaders - With sound. Also supports Lunar Rescu ...
(Added 2006-08-08, 352 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 322 hits, more)
Search:

Tags

gp2xpectrumremixesnsfedgecolemacademicfpseaixid softwaretgemufpgasolutionspetdtvibm pcrick dangerousprogramminghardwarepinoutswindows cemameconvertersultimapdffinal burncemulatorscompatibilitymsxboulder dashneo geoti-89colecovisionzopharqlsoftwaremastertronicinterviewfujitsuzx81os/2screenshotsgiana sistersmp3multifaceshmupsimagesfm-7epsoncaanooastrocadekegsosxcollectingvideo gamesatari stegnuboy65816game designrom hacksmagnetic scrollswinuaedumpingndsscansgermandocs68ktosaltaironlinebabybluemsxrecompilerinterviewscoversphotosbbc basicguidesmartphonetutorialiffpcemulefeaturewscspace questpocketpcpc-fxdavid foxmega manmodsgradiussaturnuae4allralph baerspectravideoc64ngpspace invadersinfocomfaqwalkthroughgeocitieshomepageemulationagimididarcnesgizmondop2000libraryplugincalculatorunixflashcartsmarat fayzullinmuseumdatabasebbcnewsthalioncreativisionbox shotstcp/ipcpusmallnecukx86tvgremlinsoundmerchandisemaniac mansiongamecubewikicomicskonamij2memtxabandonwareelectronapple 1abc80neopop3d realmswindowspc-88lost sourcescott adamssupervisiongamebasebiospeoplejswsquaresoftatari 8-bitascii artsfcfrontierduke nukeminstallersapogeewiijapanesetimelinengcdintellivisionmaemowolfenstein 3dmac pluswikipedia6502columnspublisherpowerpctype-inatomcoconeopocottsonybooksgeneratorvic-20incompleterottbeosfmsxmessandroidrichard bannistersonicsegamarcel de kogelaction replayappleamigadosboxpatchesc128kim-1hintshistorypaul robsonpointlessgrim fandango8-bitc16pc enginevcsfellowcheatsvisual basicsms pluscopy protectionstudio 2risc ospom1descentsymbiansam coupévicekigbblogjumpmanz-codeoricvbacivilizationmz-800toolchainstoryartworkformatscapcommz-80conversionmupendiskmagsremakesssemstellatrs-80scorpionadsarcademega driveforumcollectionfan gameshucfm townsyoutubesharpdebuggergbatranslationsgamasutrahexenadventure gamefreebsdmusicbasicdma designddjdnaatari 5200jaguarbookms-dosxzxfan fictionfusewonderswanidepsxasciiartfamtasiagithubtoshibaconsolesconverterpokesfirmwarevgbchronologyzauruscpchandydownloadsshopusenetmacstreamingpcwfrenchff7versionssolariscompetitionmo5net yarozemark3.netbeebrom listingsauctionsarchimedeslittle johnxm7scummiosopen sourcejavaarstechnicahereticn64charles macdonaldzorkbard's talepcsxtechnotesnintendogp2xendingsmartin korthquasi8832xfcegamenetworkingschematicsmediaacornik+introductionpentagonsharewareatariunreleasedcasiorpgsatari800downloadlisaseriescompilersoundtracksx1articlescastawaysource codebo zimmermansgbmo6psfdelphirom hacktoolsthomtoolebayfaqsnesterdemomonkey islandti-99/4acodeuaehumorbenj edwardsmetal gearmike daillyretrodevsunosscummvmtrailblazerreplicaspiratesdottjapandragonjum52sdlcartridgeqnxnamcoemulatorron gilbertpandorapsionteousto7adventure gamesti-923doexcerptdemosjrpgodyssey2composerscomputerswizitalyfan artshmupclonesfanzinebugsbiographywalkthroughsonline playcartridgespreservationpasswordscp/mxgsmoviessierrascigbccharactersgccmipsspainflyersrzxcreatorspc-6000datasheetsnewslettersitgermanydingoosmsgame gearcd32tnkapple 2gsjrpgsx68000gp32hi-scorescultureftpcomputerwinampxboxenginesimcoupelynxoperating systemllamasoftmanualsmastergearcps2unmaintainedgame boydoomsnes9xolafnesfolklorezx80newslettergalleryhpcamputers lynxclubcomputingradiomailing listsdktaitocensorshipps2linuxportcommercialibmtriviagamesencyclopediamagazinessc-3000jeff minterromssovietcd-iassemblerphilipsatari stzx spectrumharvestpv-1000handheldvideosgraphicspasopiasg-1000videomaking offrancesf-7000palmosguidestandyreferencearchivechip8mac osarmjupiter acevirtual boyindiana jonesmz-700articlearcadiarainbowopenglcompressionmapsinfonespc-98final fantasyreviewselitefdsspritespodcastmagickitinterpretersarchivedmagazinecatalogaquariusnesinterpreterspecssinclairarnoldresourcesquotessega cdplayersmanualanalysissnatchercommander keenatari 7800xm6tutorialsrpggenesis plusvectrexhead over heelssnkcopiersboycott advancengpcosf/1compilationsremakedemo scenenvggpladamrom hackinglucasartsto8luxorneo4allapple 2masterfrodoplus/4vaxdreamcastsidi18nlinkspc98pspddrcommodoretoshiya takedaz80strategyhitchhikeriahugues johnsonunderdogsflashamstradbasicnesgif