space invaders

link thumbnail E++
E++ is a portable, OO emulator. It is designed to be flexible and easy to extend. The current version runs under DOS only. This version has Z80 and 6502 cores built in, and emulates the
following systems:
  • Sinclair ZX Spectrum - With sound through your sound card,
    and Kempston Joystick support.

  • Space Invaders - With sound. Also supports Lunar Rescu ...
(Added 2006-08-08, 414 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 395 hits, more)
Search:

Tags

underdogsgithubngpprogrammingpspdownloadsegarainbowharvesttaitofeatureintroductionneszorkhardwareatari stegp2xpectrumhitchhikerunmaintainedsolarissnkbookscompetitionremakespc-88japanesegnuboygradiusedgezaurusplayersiospocketpcschematicsrom hackinghandheldz80little johnik+generatormastertronicrom hackasciiartconsolessdkps2studio 2hintsjupiter acecalculatorsonytandywsccivilizationcolemsciunixcamputers lynxspainstorysg-1000converterpeoplevicerichard bannisterarchivedrottiaaquariuscollectingdemo sceneatari 7800tutorialsarticlemetal gearcomics3doibmmega mansf-7000gbcspritesgrim fandangogamebasejaguarmessbeosopen sourceonlinejapanftparchimedesbooktechnotesscummmac plusnesterspecsgenesis plusqlneo4allsmartphoneos/2downloadsguiderzxfinal fantasydatabasegamasutrafellowendingscompilationsboycott advanceduke nukemabandonwaremac osibm pcinterviewsadsmerchandiseelitesupervisionteosaturnpentagonnsfnewsletteramstradpreservationgamecubedavid foxmaniac mansionhumorcatalognintendopdfcensorshipsnatchersoftwaremark3mz-700commander keenmike daillycomputinghistorywindowsto7mo6trailblazerspectravideopom1quotesnecplus/4applemz-80mulefrenchdingoodatasheetsrpgsarticlescomposerscd32thalionspace questclonesreplicasvisual basicmastergeardemolucasartscompressionssemapple 2delphiemulatorfpsemailing listarstechnicaphilipsmuseumvbajeff mintersnes9xrom hacksapple 2gssquaresoftsovietdreamcastp2000cheatsralph baeratari 5200chronologyscorpioncreatorsdma designpc98pinoutspublisherguidespandoravcsfirmwareatariitalyengine.netcollectionlinuxchip8compilernamcowikipediacharactersmodscapcomblogpasswordsmapsrecompilerfan fictiondumpingddjcastawayhpgbazx80flashcartsintellivisionsolutionsmz-800winampmanualsolafnesmarcel de kogelbiosvectrexcpcitx86z-codeinterviewccartridgeslibraryluxordemostimelinetoolodyssey2psionngpcmp3soundtracksusenetsoundinfocomhugues johnsonstreamingatari 8-bitconvertersfpgadarcnespokesultimaretrodevpcsxvideohead over heelsapple 1uaems-dosemulatorsarmnewslettersgame designfrodoradioformatssharppsfgermanpowerpcti-92faqsvgbneopopj2mesimcoupesmallebaykigbpv-1000cartridgendsosf/1masterfujitsumo5game gearzx81xzxbugspaul robsonhucfusesource codereferencec64pc-fxosxthomzx spectrumgifpcwreviewsarcadiagccnet yarozecomputersassemblergame boyportmega drivemediaagibluemsxmupentnkindiana jonesbabymaczopharbo zimmermantoolsdocsgamesuswikinetworkingwindows cediskmagsgizmondofan artgermanypalmoscolecovisionhereticcharles macdonaldjum52androidconversionrpgpsxflashsgbpiratesnvgaltairfaqscott adamstranslationsapogeerick dangerousmartin korthrom listingscoversmoviesscanstype-inremaketvmagazinephotoscp/mstellahandycodesonicfinal burnforumfmsxcommercialbox shotsfrontierpatchesi18nmtxdescentxm7tcp/ipmanualascii artstrategyacornjrpgskim-1seriescompatibilitydoomsharewarekonamicolumnswalkthroughc16virtual boymagickitdebuggerneo geokegslinksacademicarcadeauctionsbasicnespc-98graphicstgemusierraanalysisinstallersc128javaromsjrpgsam coupĂ©biographyfolklorewiimagazinesopenglidexboxmusicatari800online playbard's taleadventure gamenewsbasicsidcultureukatari stsc-300032xunreleasedto8n64creativisionoperating systemdnagp32screenshotsfcehexenscummvminterpretersvaxcaanoofm townscopy protectionsunosgalleryshmupsfm-7remixesvic-20famtasiaencyclopediaversionsjswcopiersmarat fayzullinpetemulationpasopiaquasi88dragonmamevideossfctriviacocoepsoncd-ixgscps2pointlessneopocott65816lynxjumpmanyoutubemultifaceatomsega cdbbc basicwalkthroughsmagnetic scrollsdosboxmips68kshoppc engineid softwarefreebsdhomepagewonderswansdlti-99/4afdsgiana sisterstrs-80dtvwizoricaixresourcesmaking ofsinclairqnxtoshiya takedagplsymbiangamemsxcasioarnoldcpuflyerstosff7archivemonkey islandbbcpodcastartworktoolchainwinuaeclubx1uae4allplugincomputerti-89benj edwardsamigacommodorengcdsms plus8-bit3d realmsexcerptaction replaybeebboulder dashmidi6502pc-6000adventure gamesincompletedottlisaastrocadefan gamesifimagesxm6interpreterddrtutoriallost sourcesmsabc80space invadersgp2xadamfanzineshmupvideo gamesx68000geocitiesmaemotoshiballamasoftinfoneselectronfrancerisc osgremlinron gilbertfpcewolfenstein 3dhi-scores