solutions

1 2 >   Next Page >>
link thumbnail Interactive Fiction Archive, The cool
All the interactive fiction-related stuff you can download: Artwork, articles, books, tools, games, interpreters, magazines, programming, solutions, and more.
(Added 2003-11-12, 711 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 525 hits, more)
link thumbnail Adventure Solutions
Dorothy Millard's portfolio of text adventure solutions.
(Added 2006-09-14, 668 hits, more)
link thumbnail Adventure-Archiv de translate
Large database of adventure games with short descriptions, box and screenshots, and links to publishers, developers, related sites, reviews, and solutions.
(Added 2006-09-24, 901 hits, more)
link thumbnail Amiga History Guide
This site examines a kaleidoscope of topics, ranging from Amiga Inc.'s early foray into joysticks, to the latest offerings in cross-platform Amiga solutions.
(Added 2003-11-12, 340 hits, more)
link thumbnail Atari 800 Page
Harvey Kong Tin's Laser Hawk/HawkQuest page, with manuals, technical information, info on Andrew Bradfield, game downloads, hints, and solutions.
(Added 2006-08-27, 507 hits, more)
link thumbnail Boulder Dash Fansite, Arno's
All about C64 classic Boulder Dash: review, walkthroughs of Boulder Dash I and Boulder Dash II, description of the rules of the game, interview with creator Peter Liepa, solutions and downloads of fan games.
(Added 2007-01-09, 369 hits, more)
link thumbnail C64 Adventure Game Solutions and Walkthrough Site, The ende
Solutions for Commodore 64 adventure games (most in English, some in German) and a forum.
[Appears to have a mirror at c64.org.]
(Added 2003-11-12, 635 hits, more)
link thumbnail Classic Adventures Solution Archive, The
CASA features solutions for over 1000 text adventures from the 8-bit era.
(Added 2003-11-12, 367 hits, more)
link thumbnail El sitio del Amstrad CPC es translate
Dedicated to the Amstrad CPC, hard to find games, demos, adventure solutions, articles, ad scans, and reviews.
(Added 2006-08-17, 713 hits, more)
link thumbnail Lankhor.net fr translate
Site on French developer Lankhor; very thorough, even contains a complete list of employees, not to mention game downloads, manuals, solutions, scanned articles and so forth.
(Added 2003-11-13, 1120 hits, more)
link thumbnail Lemon Amiga
Amiga game directory with basic data, screenshots, magazine reviews, community reviews, hints, solutions, and links to related games, download sites, and conversions in other system-specific databases.
(Added 2005-12-28, 265 hits, more)
link thumbnail Longplayer de translate
… eine gute Lösung nach der anderen. Solutions and walkthroughs from German magazines.
(Added 2003-11-12, 694 hits, more)
link thumbnail Mercenary Site, The
Dedicated to Mercenary, Damocles, and Mercenary 3. Hints and solutions, pictures, manuals, reviews, a web forum, and a remake ("MDDClone") for all major platforms. Also has information on the various versions that have been released, the unreleased PC version of Damocles, on the Novagen team (with several interviews), and lots more.
(Added 2006-08-31, 270 hits, more)
link thumbnail MSX Solutions
Maps and solutions for MSX games.
This page was created to host all the maps I created in order to solve MSX Games.
(Added 2006-10-04, 253 hits, more)
1 2 >   Next Page >>
Search:

Tags

box shotsbookxboxasciiartsdlqlculturepandoraacornsnknewscolecovisionwolfenstein 3dboulder dashz80vbadocsfujitsuwizfolkloreelitedottdtvgp32adventure gamehpjeff minterflyersschematicsapogeerottquotesmagickitpc enginecastawayrecompiler32xforumgithubepsoncommodoremidipokesc64handheldarcadeddrfrontierresourcesgamasutradragoncomputersdemococopv-1000bbc basictoolsneopophead over heelspowerpc65816trailblazerfrodoron gilbertsoundtrackscompetitionmac osmipsgamespodcastcreatorsgbapspcompilationsinterpreterswinuaecataloggamemega mansnatchersonicpcwgnuboyscummpsfvicecharles macdonaldpcsxpublisherinterviewsbo zimmermanfellowtutorialskim-1rick dangerousti-92beosdnasidngcdtandyfeaturejrpgscreenshotsportreviewsmupengame designbasicunmaintainedmoviespaul robsonmaemomagazinechronologynamcoremakepc-6000javaopenglgp2xpectrumataribiographysource codemp3smssharppocketpcwikiradio3dostellafinal fantasyarchimedescartridgesmediawinampfreebsdcompressionfan gamestaitosharewarearcadiagalleryarstechnicasolariscolemx86coversjswjupiter aceformatsitalycpcapple 1manualsvgbbard's taleimagesdingooexcerptpasswordsuae68ktrs-80tutorialpreservationscorpionmaniac mansionpc98lucasartsmo5rainbowhandysunosik+pirateswindowshereticreferencecomputercomicsdumpinglinksdemossnes9xharvestcd32id softwareos/2cheatsaction replay8-bitodyssey2trivialuxorfamtasiaunixzorkatomrom hackwscwalkthroughrpgsartworkcomputingpointlesscompilerrom listingsyoutubewindows cesfcrichard bannistergbcmega drivecensorshipcasiocps2videocartridgeincompleterzxthalionlost sourcephotospasopiapc-fxarchivepetsegafm-7genesis plusdma designencyclopediasega cdzx81faqfuseconvertersshmupsgermancivilizationtimelinecommercialnvgonline playduke nukemdownloadindiana jonesemulationgccnintendofrenchsmallpentagonfm townsgremlinolafnesfan artcolumnsgp2xukc16pinoutsddjdavid foxxm7sinclairsquaresoftosxcp/msierramaking ofsupervisionarnoldx68000mtxelectronconverterbluemsxcomposersenginetcp/ipibmps2to8librarywiiqnxsonyhucinstallersopen sourceamigacollectiongamebasespainlynxhi-scoresrom hackingiosebayvideo gamesguidemastertronicmac plusacademicspectravideohitchhikergifmsxbiosreplicasvaxtossolutionsgraphicshintsprogrammingfpserisc osdreamcastfirmwareretrodevrpgfinal burnatari 8-bitandroidmailing listastrocadeinfonesidecharactersinterpreterfrancesovietaltairabandonwaremanualemulatorsstudio 2ti-99/4axm6spritesconversionspace invadersassemblerapple 2gstype-inmo6newsletternesssempatchesgame gearmartin korthscansatari stecoderom hacksndsatari 7800zx spectrumdosboxcalculatorcaanoomz-80clubpluginmetal gearnet yarozehardwarep2000fanzinemark3armmz-700babysdkuae4allhumormusicxzxversionsn64jrpgsms-dospc-98camputers lynxremixespdfsoftwareclonesadamusenetmonkey islandguidestoolfmsxtoshiya takedacapcomcommander keenblogthomflashcartshistorymagnetic scrollspalmosunreleasedfdsstreamingbbcconsolesendingsvectrexflashneopocottvisual basicdemo scenemesshomepagearticleboycott advanceinterviewatari800fpcemagazinesadsnsfmike daillyarchivedmamebasicnesff7wonderswanti-89marat fayzullingradiussc-3000ngpcfcegizmondoifstrategyvic-20j2memulefaqsteointellivisiononlineiaabc80kigbmerchandiselisadebuggergamecubeftpbeebzauruspsxpom1shopsf-7000toshibaneo4allgeocities3d realmsjapanto7itsmartphonetranslationslinuxspace questjum52c128saturndoomosf/1generatorneo geocreativisionmastershmuporicultimamuseumxgsus6502cd-imodsstorycollectingnesterscisimcoupeinfocomngpkegsjapanesegplmastergearmapsscummvmzopharcpudatabaseagisam coupétvnetworkinggame boytoolchainpsionralph baertgemux1soundscott adamsedgecopy protectionchip8virtual boyz-codei18napple 2compatibilitydarcnesjaguarlittle johnnecczx80llamasoftemulatorvideosdiskmagsspecsarticleswalkthroughskonamigrim fandangoibm pcbugsplayersatari stfan fictionunderdogssms pluspc-88ascii artpeoplequasi88aquariussymbianmz-800hugues johnsonauctionsbenj edwardsromsdatasheetsbooksamstradfpgatnkaixdescenttechnotesadventure gamesintroductiondelphimacplus/4wikipediaatari 5200seriesremakescopiersphilipsnewslettersapplesgboperating systemsg-1000vcsanalysisgermanymarcel de kogelgiana sistershexendownloadsjumpmanmultiface.net