screenshots

1 2 3 4 5 >   Next Page >>
link thumbnail About Acorn computers and ARM processors
History, hardware, prototypes, software, operating system, screenshots, and more.
(Added 2003-11-12, 511 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 482 hits, more)
link thumbnail Adventure-Archiv de translate
Large database of adventure games with short descriptions, box and screenshots, and links to publishers, developers, related sites, reviews, and solutions.
(Added 2006-09-24, 860 hits, more)
link thumbnail Alternate Reality Homepage, The Original
FAQ, games and music for download, screenshots, guides and cluebooks, maps, and more.
(Added 2003-11-12, 342 hits, more)
link thumbnail AmigaMemo.com ende
Amiga game museum; classics, rarities, and highlights of Amiga gaming history.
(Added 2007-03-21, 392 hits, more)
link thumbnail Amstrad ESP es translate
almost complete catalog of Spanish games for the CPC, with screenshots and downloads, articles about Spanish software houses, cheats, and a forum; registration required!
(Added 2006-02-24, 801 hits, more)
link thumbnail Apple IIc .dsk Archive fr translate
Small Apple II game and utility archive with screenshots.
(Added 2007-09-04, 495 hits, more)
link thumbnail Area64
C64 games, demos, emus, utilities, and music. Games and demos with screenshots and reviews.
(Added 2007-01-06, 483 hits, more)
link thumbnail Atari Legend
Atari ST game database, reviews and interviews. Downloads require registration.
(Added 2006-09-01, 397 hits, more)
link thumbnail Atarimania
Database of Atari games for 2600, 5200, 7800, XL, XE with scans, dumps, reviews, screenshots.
(Added 2006-08-27, 374 hits, more)
link thumbnail C64 Endings
Screenshots of Commodore 64 game endings
(Added 2006-07-05, 459 hits, more)
link thumbnail C64 Game Guide
This page contains short info and screenshots from many of the old classic C64 games, info on companies and people.
You can also find a little shop-page and a Q&A page here.
(Added 2003-11-12, 411 hits, more)
link thumbnail Chaos Regime, The
Bitmap Brothers tribute
(Added 2003-11-13, 633 hits, more)
link thumbnail Charin's MSX Homepage
Game screenshots, maps, and music, TurboR software, photos, emulators, utilities, documentation, connector pinouts, etc.
(Added 2006-09-24, 382 hits, more)
link thumbnail Commodore 64 Preservation Project
Project aiming to archive pristine versions of original Commodore 64 software, including copy protection. Site features information on C64 copy protection techniques, a disk database, emulator patches, and a collection of Ultimax cartridges with screenshots and technical information.
(Added 2007-12-11, 279 hits, more)
1 2 3 4 5 >   Next Page >>
Search:

Tags

sega cdebaypatchesguidesmultifaceatari 5200x68000cartridgesindiana jonesgp32sdlbeosfujitsuwikisoniccmerchandiseemulatormastergeartvfan artfinal fantasymanualsinterviewssharpcensorshipaquariusstrategyarticlesultimacd-insfsnatcherlynxpsxfanzineuaetoolddjcomputingenginebasicnesformatsromskim-168kdownloadsfreebsdgremlinforumarchivedrzxmagickitibmcompilerconvertersmagazinecd32type-incolumnsmega drivepaul robsonfrontiernintendop2000francebugsvideosfpgacompatibilitywsctriviajapansnes9xadventure gameshandymarat fayzullinspritesepsonmz-700programmingreplicasfan gamesatari steapogeeradioastrocadesaturnusmetal gearfm townsintroductionamigaamstradcolempc-88vbaibm pcassemblerstelladocsscummvmjrpgsftpyoutubeflyerstoshiya takedacodedemosdescentgeneratorversionscopy protectiongenesis plusunmaintainedssemzx80atari stmac osacornpom1luxorx86unreleasedgiana sisterssdkwindows ceschematicssquaresoftrom hacksoperating systemjavaxgsmz-80tnkspectravideomediavgbdragondottremixesz-codefeaturetrs-80charactersscanswiigame gearsmscomposersiaretrodevvideo gamesdemo sceneonlinepokesti-99/4asierradnapeoplexzxpsionsunosdownloadfm-7hintsandroidascii artdtvhereticinterviewpowerpcmiditandybox shotsmp3timelinecatalogvcsdoomtoslucasartstechnotespcwemulationasciiartcheatsteoclubedgeelectronmailing listfirmwarequotesdatasheetscommander keenngpcn64iosatarimusichardwareto7winuaedebuggermark3wonderswangamescalculatormanualwizrick dangerousvic-20vaxfolkloreacademicrecompilerwolfenstein 3dcaanoopreservationfdsitalysmallarstechnicaapple 2gsrottxm7frenchexcerptspaineliteflashwalkthroughssoundid softwaremastertronicfmsx8-bitdelphibookphotosadamtranslationspinoutsrisc oscamputers lynxmupendma designngcdmsxifmaemosoftwarejrpgtoolsgbauae4allrichard bannisterbabygbcshmup6502bbcunderdogsspace questopen sourcetutorialinterpreterspspfaqmega manshopphilipshomepagesupervisiondarcnesnamcocpcmartin korthfaqsmamenewsletterclonestoolchainscott adamsthomdumpingsolutionsvideosfcaction replaymo5jum52c128famtasiaappleshmupspocketpccivilizationincompletepublisheradstcp/iphumorculturesolarisstudio 2ms-dosblogodyssey2cocoguideatari800kigbsf-7000macmonkey islandsidfrodogp2xpectrumosf/1ti-89pc-6000seriesabandonwaredemooricharvestcartridgescipv-1000bbc basiccomputerspc98abc80bo zimmermanunixnvgdosboxgamasutraconsolesgame boymessport3d realmsto8jswhugues johnsoncreatorspasopiahi-scoresi18nmoviessnktrailblazertutorialspandoraarmsharewaremuseumbard's talehucnewslettersmodscollectionhistoryarcadezx spectrumtoshibasam coupéfan fictionwalkthroughneopopidegamecuberom listingsboycott advancecomputerduke nukemkegsatari 7800ddrqnxrpgsquasi88podcastmo6artworkgermananalysisgallerywinampmac plusplus/4mz-800pc-98pcsxstorysmartphonecomicsgeocitieslibraryfellowhandheldusenetmtxcopiersgp2xapple 2pluginaltairmaking ofplayersbiographygifgcchexen.netnesinfocomnetworkingemulatorsx1rpgdatabasecharles macdonaldbluemsxmarcel de kogelscummvirtual boymagazinesti-92githubsymbianconversionhitchhikermagnetic scrollsarnoldpsfhpstreamingarticlechronologymulecompressionfpseaixbenj edwardsarchivefcewikipedianecndslost sourcenet yarozeneopocottpiratesadventure gameff7sinclair32xmipsgame designresourcesarchimedescasiocps2fpcemike daillyralph baersoundtrackscommodorescorpiondiskmagsmapspc-fxvectrexgnuboyfusevisual basicgermanypdfdreamcastjapanese3dopc enginemaniac mansioncp/mcoverswindowscastawayflashcartsreferencegamebasenesterolafnessc-3000atomjaguararcadiazorkgameik+rom hackingneo4allinterpreteritatari 8-bitmasterpointlesstgemuapple 1taitolinkschip8encyclopediangpgradiusinstallerssegacapcomgplc64commercialrom hackzx81grim fandangoendingssovietopengljupiter aceron gilbertsgbosxpalmoscreativisionimagessonyz80bookspasswordsjumpmangraphicsxboxlinuxcolecovisiondavid foxpetfinal burndingoocompetitionpentagonc16ps2cpubiosreviewslittle johnj2meqlspecscompilationsspace invadersbeebthalionsg-1000remakesconverterllamasoftsimcoupeinfoneshead over heelszauruscollectingos/2agixm6source codelisarainbowscreenshotssms plusvicejeff minterzopharukboulder dashnewsremakekonamionline play65816basicintellivisionauctionsneo geogizmondo