roms

link thumbnail Index of /packages/openmsx/roms
System ROMs for openMSX.
(Added 2012-10-08, 435 hits, more)
link thumbnail PDRoms
PDRoms is a website taking care of homebrew console, handheld and mobile phone software. We do have regular news service and plenty of downloads for plenty of systems. We usually do not report about commercial software, but might make an exception once in a while. Everything here is Freeware, Donation Ware, Open Source, Public Domain or has otherwise been legalized for free use by thei ...
(Added 2006-08-28, 253 hits, more)
Search:

Tags

humorinstallersmz-80powerpcfcefaqsdiskmagsatari 7800galleryabandonwaregbataitoarchivedmarat fayzullindemospc-6000videosto8acornbeosarticleluxoryoutubepentagonmike daillyendingsforumxm7demo scenecolumnsinterviewopen sourcejrpgsclonesremakesgamebaseasciiartddrwikipedialinuxbox shotsmac plusrecompilerstory65816gamasutrams-dostgemunewslettersfolklorezx spectrummuseumbasicnesxm6bookjrpgjaguarabc80thaliononline playimageshi-scores3doadventure gamescfreebsdfrodohandyunderdogsc128blogxboxrichard bannisternvgpetfanzinecd-imagazinesz-coden64mega mancatalogpcsxsegamoviespv-1000jeff mintercoverscamputers lynxvic-20intellivisionsinclairscummvmpsfxgssaturntrs-80little johndreamcastiosdocscharactersiasoftware8-bitmtxjupiter aceguiderom listingsarcadiaencyclopediatoolssource coderick dangeroustranslationsx86visual basicsdkculturebeebatari stei18npublisherpsionkigbgamesunossimcoupemartin korthfpceitalyradiogbcadampodcastpc-88tutorialspsxaltairmapsgame gearsg-1000zaurusclubrisc oscollectingmupendingoofaqneo4allodyssey2gp2xpectrumunreleasedmipsinfocommastermz-700articlesdragonmsxmark3winuaeps2usrottcommander keenlisanewsgithubconverterspcwfinal burnjum52compilerwolfenstein 3dmanualscps2graphicscodewizbbc basicpirateswalkthroughremixespc-98quasi88game boyatarinet yarozesierrapalmoscopy protectioncivilizationbasicfujitsufdscommercialpc-fxwscdownloadslucasartscartridgevaxhucsmallmailing listsms pluspandoragradiuspatchesgeneratormidiapplehardwaresega cdsgbvirtual boyretrodevsmartphonegccsharewaresharpwikiamigaemulatorscocoboulder dashqnxmerchandiseto7comicsvideorainbowdebuggerinterviewsscibiographyacademicstudio 2nectechnotesprogrammingcheatsfm-7neo geodnacompressionkegsarnoldpom1multifaceneopopzorkcartridgescastawayascii artemulatortrailblazerreferenceuae4allmo6computersupervisionid softwaretandyscansvcsti-99/4ahitchhikeratari 5200scott adamszx80ff7demoresourcesdescentlinksarchivewinamptoolchainmac oshereticosxschematicsharvestthommamezophardatasheetsgifmagickitnetworkingti-89babycd32rzxatari800strategybo zimmermanassemblerkim-1sonicvbacreativisionsoundzx81modsscummspain32xmaniac mansionrom hacksebayadventure gameinterpreterbenj edwardsaixcollectionportultimamagazinepdfapple 2gsfinal fantasyquotesmp3germanyreplicassmsedgepinoutsnsfsoundtrackscolecovisionplus/4bluemsxmuleconsolescolemcalculatororicdavid foxrpgfm townscompatibilitymastertronicepsonsquaresoftidevgbromsanalysisngpcjapanesellamasoftagistreamingbugsspace invadersj2mehandheldcharles macdonaldpointlessfan artpocketpcx68000c16screenshotsolafnesadsbbcp2000openglwindows cefmsxviceindiana jonesdownloadastrocadeaquariusconverterjswincompleteitamstradcpcandroidflashelectronik+geocitiesartworkspace questkonamipokesz80giana sistersformatsfamtasiawindowsapogeesdl68kstellaapple 2boycott advancearcadefeature.netwiishopfan fictionaction replaysam coupĂ©ron gilberttriviaspectravideofrancecpugplmastergearx1atari 8-bitintroductiontvsolarisndsphilipsauctionscreatorspeoplepc98apple 1passwordsphotosukonlinebard's talenesterrom hackingmz-800computersdtvflashcartsssemmediacommodoretoshibalibrarychip8tcp/ipsf-7000marcel de kogelcp/mpasopiaralph baeremulationjavafirmwaredottrpgshugues johnsontutorialeliteuaeplayersarmdosboxfuseshmupfpgaduke nukemdelphigenesis pluscapcomtosvideo games6502snkmega driveftpc64qllost sourcengpmaemointerpreterstoshiya takedaflyerssolutionssovietngcdnesgp2xjumpmanunixgermanosf/1vectrexmacdatabasecopiersconversionsfcos/23d realmsbooksmo5casioarchimedesneopocottplugindma designfellowgrim fandangoibm pcsidmaking ofcomposersusenetpspversionsnewsletterdoomenginespecsjapandarcnespaul robsonsymbianscorpioncensorshipgame designpreservationsnes9xmusicmagnetic scrollsgizmondotnkhistorytimelineatomgp32chronologyhexentype-ingremlinmonkey islandtoolwonderswangnuboywalkthroughsexcerptteocompetitionddjinfonesmetal gearcaanoosc-3000operating systembiosibmarstechnicareviewslynxspritesnintendosonyxzxrom hackpc enginefan gamesunmaintainedfrontierti-92snatcherhead over heelshomepagemessifseriesremakefpsedumpingcomputingfrenchshmupsmanualcompilationshpgamecubeguidesatari stnamcohintsgames