roms

link thumbnail Index of /packages/openmsx/roms
System ROMs for openMSX.
(Added 2012-10-08, 382 hits, more)
link thumbnail PDRoms
PDRoms is a website taking care of homebrew console, handheld and mobile phone software. We do have regular news service and plenty of downloads for plenty of systems. We usually do not report about commercial software, but might make an exception once in a while. Everything here is Freeware, Donation Ware, Open Source, Public Domain or has otherwise been legalized for free use by thei ...
(Added 2006-08-28, 221 hits, more)
Search:

Tags

aixmsx68kfmsxcocosovietc128vicexm6linuxnvgconsolesmanualszx spectrumgizmondognuboycomputersddjdragonsierrawizcartridgesonycharactersmarat fayzullinsg-1000paul robsoncastawayphilipsmo6dreamcastpentagonllamasoftincompletejaguarpiratesgamecubecomicshitchhikermididocskigbstellagamesanalysis65816neopocottpatchesboycott advancedebuggercps2jum52pdfplugin3dobiographybookepsonmanualiaatari 8-bituaecartridgesmupencatari 7800rpgsfrodomastertroniccivilizationscummarticleslynxbox shotszopharjupiter acevisual basicatari stshmupti-92datasheetsscorpionndswindowsamstradlibrarysoftwaresega cdelitetimelinekonamitechnotesgradiusscanscommander keen.netbiosjapanpc-fxtoscharles macdonaldtoolvgbartworkwikipediacalculatorfpgaassemblerpc-88sdlmaemozx80rick dangerouswiinamcosupervisiondosboxdemopokessoundibmabc80strategyuae4allfrenchgbcx68000networkingibm pcz80mapsssemarstechnicaluxorcultureremakesbasicfinal fantasylucasartsplus/4openglcreativisioncd-ijrpgseriesconverterencyclopediadottshmupsfujitsuchip8toshibaarnoldgp2xgenesis pluscreatorsbard's talemz-700referenceinterpretershistorydoomqnxapple 1bbcnsfgplinfonesporthomepagepalmosms-dosc16masterthomelectronsoundtracks32xguidecpcrecompilerfpsecoverspasswordssinclairifz-codeforumscistudio 2preservationmultifacesdkdnaagiinterviewsddrmoviesremixeshardwarerom hackinghereticdarcneskegsamigaspectravideomz-800fan artbenj edwardspasopiaflashcartsvideospetwikidownloadscommercialdtvarcadehugues johnsondavid foxvideowinamppeopledemosshopjeff minterasciiartopen sourcesharpyoutubesymbiansnkmac plusitalymusicn64bo zimmermangp2xpectrumsnatchertaitomtxcataloggeocitiescompilationsfaqsscott adamsmerchandisespace questvaxpsxfaqascii artplayersdemo sceneadventure gamebeebtrailblazerwsccomposersodyssey2atari800introductionemulationngpvideo gamesnecvbaapple 2gshandheldc64gameflyersgraphicsunreleased6502compressionsmalltgemumipstoshiya takedapv-1000bookscheatsngcdacademicmike daillysf-7000franceosf/1itarchivedsmartphonejapaneseabandonwaresquaresoftsource codefrontierjavavectrexpocketpckim-1gamasutraboulder dashspaingithubustv8-bitfellowmesssegamark3radiomaniac mansionwinuaelost sourcepc-6000conversionmagazinehandyadamj2megermannewslettersschematicsquasi88neopoptandyron gilbertaquariusandroidintellivisionendingsbluemsxvirtual boycollectingthalionxgsusenetenginecompatibilitydma designgcctrs-80fpcereplicashexennewsxm7nesterpspti-89toolsphotosgbacollectionrottiosarmfm-7indiana jonessolutionspodcastgamebaseolafnessmsgermanyx1colecovisiondelphidumpingatari stebeossonicmodsspritesinterpretersgbidespace invadersarticlemarcel de kogelunderdogsatari 5200pc engineapplegifnet yarozebbc basicbasicnespandoramagnetic scrollsapogeetype-inxboxtnkbabyi18nsharewaregame gearneo4allresourcescomputingscummvmpsfwalkthroughsgame designfirmwarexzxmuseumfeaturex86atarimega drivefinal burnfm townsid softwareonline playngpccp/mpom1astrocadeoperating systemtriviaclonesnewsletteremulatorcolemzx81sc-3000saturnpublishertutorialsrom listingsstreamingprogrammingsam coupĂ©metal gearrainbowwalkthroughcensorshipaltairpcsxzorkonlinegp32fdsspecsrzxcolumnsjrpgsmega manos/2fanzineatomdingoogeneratorpointlesszaurustcp/ipcodeacornvic-20capcomclubfamtasiaff7cd32humoradventure gamespcwfan gamescomputerreviewsmamehintslinksmp3ik+ps2harvestnesralph baercompileremulatorscopiersmulesimcoupepowerpc3d realmsdatabaseinterviewromsauctionssidmacto8storyapple 2magazinesexcerptnintendovcsmz-80solarisquotespc-98imagesblogcasioformatspsionarchivesms plusrichard bannistertranslationsmaking ofrpgfusecamputers lynxti-99/4agremlindescentqllisaflashmediafreebsdmartin korthsnes9xteorisc osguidesukpc98mo5installersremakecopy protectionjsworicunixunmaintainedmailing listgallerytutorialp2000chronologyjumpmanhucultimabugsdiskmagswonderswanftpsfcdownloadcommodorefolklorefcehead over heelsmastergearduke nukemmac oscpuhi-scoresto7magickitversionsneo geoarcadiagame boytoolchainlittle johngiana sistersscreenshotsfan fictionpinoutsrom hackadscaanooedgemonkey islandwindows ceaction replaysunoscompetitionebaywolfenstein 3dhprom hacksconvertersgrim fandangoinfocomretrodevosxarchimedes