psf

link thumbnail PSF Central
PSF (Portable Sound Format) is a simple, flexible format for emulated music on a variety of 1990s-era and later game systems. PSF brings the functionality of other formats such as NSF, SID, SPC, and GBS to more modern consoles and arcade systems. By using the original music driver code from each game, sequenced music can be played in a perfectly authentic, and size-efficient, way....
(Added 2003-11-12, 577 hits, more)
link thumbnail Zophar's Domain: PSF1/PSF2 Archive
PlayStation music archive.
(Added 2007-04-01, 631 hits, more)
Search:

Tags

spritesguidesvbacopierszx80programmingdemosstorychronologyrainbowsnatcherlucasartstranslationskigbvideosmo6videopasswordsblog32xti-92oricspainguiderottsupervisionnesterfpcecreatorsvaxqnxphilipscodehi-scoresgamasutraataripentagonnewsletteropen sourcemac pluswindowsdarcnesedgeunderdogsinterpretersebaynintendollamasoftcopy protectionaixsolarisrpgmagazinesbbcpv-1000boulder dashschematicsmz-80making ofsdlsmalllittle johncd32hardwarepaul robsoncommercialaltairibmjrpgdownloadelectronx1unreleaseddottsharewaresc-3000triviaapogeefrenchendingsintellivisionphotosinfonessf-7000timelinesunosx68000ik+apple 2gsassemblerincompletepatchesdemoremixesos/2mailing listcolemzx spectrumunmaintainedlisatgemuformatscomposersx86technotescaanoo8-bit6502sonyadventure gamesmaniac mansionneopocottcapcomsfcc128gifbox shotswscpspbasichead over heelsgbasega cdcocojapanpreservationddrnet yarozetoshibastudio 2ngpamigaluxorsinclairbo zimmermanarcadehucrzxbenj edwardsmodsmonkey islandcamputers lynxdocsvcssms plusapple 2nesmupensam coupĂ©spectravideotossolutionspluginddjftpatari800museum65816flashhexenccompilationspokesgizmondofamtasiasonicdebuggerscansapple 1scummvmtrailblazerartworkvectrexrisc osifbeebonline playshopmsxgermandavid foxcollectiontoolmanuallost sourcesnkaquariussquaresoftgeocitieswalkthroughdoompcwralph baerdatabaseti-99/4aff7powerpcfellowabc80viceacademicpiratesflashcartsgremlin.nettcp/ipteofan gamespasopiapalmosflyersatari stuaecpcwinampn64recompilerauctionsms-dosmega drivedragonnewslettersacorncasionewsbooksianeopopreplicasz80fan fictionharvestdma designlinksoperating systemsidjaguarusenetbluemsxjswgamesatari 7800game boyemulatorsretrodevcreativisioncoverspodcastqlpinoutsmaemocompetitionlynxmac ossimcoupeshmupstvhintsmagickitjrpgsversionssegayoutubetrs-80datasheetsdtvreviewsascii artfujitsufdsvideo gamessymbianinfocomzophargamecubegplarnoldarmarstechnicahistoryclubgeneratorsdkcatalogtoshiya takedaneccd-isierradelphipsfepsonvgbcastawayfpsegenesis plusps2duke nukemgradiusfinal burnnvgthommike daillyjapanesegermanyscorpiononlinepeoplecomputerspecswalkthroughswindows cemarcel de kogeljum52hitchhikerarcadiaarticlesgamebasejavaultimagbcxzxconversionmastertronicatari steid softwaresoundtracksfm-7c16zaurusmediawikipediandsdnafpgaapplepcsxatomjumpmanmartin korthfuseibm pcstrategyfm townsfolklorec64manualsdiskmagsunixrpgsjeff mintermasterpetmipsscreenshotsbabyitquasi88articlemagnetic scrollsboycott advancedemo scenefceelitearchivebbc basicbasicnesxboxgame designrom hackgallerybooksource codecp/musinterviewscharles macdonaldadventure gamestreamingwinuaexm6seriesexcerptnetworkingfrodosharpron gilbertideolafnessg-1000firmwarefreebsdmerchandisetutorialsastrocadep2000neo4allbugscompressionplus/4convertersencyclopediacartridgedumpingcheatspsxgraphicsgccsoftwaregamemz-700fanzinecommodoremo5comicswikitoolscollectingsgbclonesatari 8-bitintroductionrom hackingscott adamshpnsfadspocketpcresourcesmultifacekonamiimagescompatibilitypc-fxj2mewiihomepageconvertermastergeargp2xpectrumiosvisual basiczorkfmsxpc-88to8smartphonecps2kim-1pdffrancelibrarycomputingdreamcastgp32pandoracalculatorinterpreterhugues johnsonwolfenstein 3dbiographyengineshmupgithubinterviewcivilizationti-89scimp3hereticitalyhandheldmusicpc enginepc98wonderswanfrontiergrim fandangoatari 5200soundthalionz-codemega mangnuboyukremakemarat fayzullinmidicensorshipchip8namcoemulatorforumgame geargp2xfeatureradioromsmetal geararchivedcolumnsngcdpc-6000mapsfan arttype-intandyaction replaymagazinespace invadersagiosxspace questabandonwaretutorialanalysisportrom hacksrichard bannistermacwizngpctnkodyssey2toolchainsmsconsolesamstraddingookegscompilerzx81androidmz-800to7quotesreferencemark3jupiter acepointlessfaqcommander keenbard's talessemvirtual boytaitolinuxscummxgsasciiartfaqshandypc-98installerssovietrick dangerousbeossaturnuae4alldownloadsrom listingscolecovisionmtxi18nfinal fantasycharacterscomputersmesshumorneo geovic-20pom1xm7emulationplayersdescentmame68k3dobiosarchimedespublishermule3d realmsadamremakespsionindiana jonesculturegiana sisterssnes9xmoviescpustellacartridgesopengldosboxosf/1