port

link thumbnail Aliens vs Predator Linux
Linux port of the Fox Interactive/Rebellion Developments game, Aliens vs Predator (Gold Edition).
(Added 2003-11-12, 443 hits, more)
link thumbnail Andre' Werthmann`s -Homepage-
Linux port of both the software renderer and OpenGL versions of Heretic.
(Added 2003-11-12, 484 hits, more)
link thumbnail asylum.acornarcade.com

SDL Asylum is a C port of the computer game Asylum, which was written by Andy Southgate in 1994 for the Acorn Archimedes and is now public domain. It should be possible to run it on any platform which support SDL and OpenGL graphics. It's developed primarily on Linux but has also been built successfully on Cygwin, FreeBSD, Windows and Haiku.

SDL Asylum is currently li ...

(Added 2007-09-10, 637 hits, more)
link thumbnail D2X-XL
Descent 2 is a pretty old game, and further development has slowed down; so there are a few issues - some still stemming from the original Descent 2 - that have never been adressed or solved in D2X.
As I still like Descent 2 pretty much, I was always looking for a way to get rid of the things that plagued me most in Descent 2. Getting hold of the D2X source files and being abl ...
(Added 2012-10-11, 250 hits, more)
link thumbnail DooM Legacy
Doom port running on DOS, Windows, OS/2, and Linux that tries to keep the gameplay unchanged.
(Added 2003-11-12, 436 hits, more)
link thumbnail DXX-Rebirth - The classic Source Port for Descent and Descent 2
DXX-Rebirth is a Source Port of the Descent and Descent 2 Engines for Windows, Mac OS, Linux, offering OpenGL graphics and effects, many improvements and new features.
(Added 2012-10-11, 300 hits, more)
link thumbnail EDuke32
It's time to kick ass and chew bubble gum, and I'm all outta gum!
The most advanced version of Duke Nukem 3D available. For Windows, Linux and OS X, supports OpenGL and has hundreds of new features. Come get some!
(Added 2012-10-11, 284 hits, more)
link thumbnail HHeretic and HHexen
Hacked Hexen and Hacked Heretic are Linux ports of Hexen and Heretic.
(Added 2012-10-11, 294 hits, more)
link thumbnail PrBoom
Greatly enhanced version of the Doom game engine.
(Added 2003-11-12, 410 hits, more)
link thumbnail Q2 LNX stuff
Quake 2 engine for Linux, Solaris, and similar systems.
(Added 2003-11-12, 367 hits, more)
link thumbnail Rise of the Triad... for Linux!
Port of DOS game Rise of the Triad to Linux, Win32, Mac OS X, and other platforms.
(Added 2003-11-12, 380 hits, more)
link thumbnail Welcome to Hast
Ports of Hexen and Heretic.
(Added 2003-11-12, 370 hits, more)
link thumbnail WolfGL
OpenGL port of ID Software's Wolfenstein 3D.
(Added 2003-11-12, 357 hits, more)
Search:

Tags

japanesewikimediafpcepatchestgemungcdcatalogpc-98ddrbo zimmermanphilipsabc80cd-isquaresoftnsfmameflashsharewarexboxclonesconversionpc98copiersthalionadventure gamejaguarscummvideosunreleasedngpcmetal gearseganamcoolafnescaanoobbcibmsunosmodscputi-99/4acheatssoundplayerssega cddownloadpublishernewsletterbooksbeossource codespace questvbaz80uae4all68kmega maninterviewsatarigraphicssimcoupequasi88wikipediavic-20sonyjswmp3mipsenginehexenflyersms-dosscorpionmartin korthduke nukemfaqgamebasepspcolumnsjrpgatari 5200remakesc64osxincompletemerchandisexgsaquariusphotosasciiartfpsewindows ce3dobenj edwardsvisual basic.netgrim fandangoarchimedesfrontierrottbabyscisg-1000ideapogeemagazinescapcomfellowxm7ndsspritesacademicflashcartscamputers lynxauctionsopen sourcevectrexvideo gamespentagonchip8portvgbspainhintsrpgcollectingshmupssinclairintellivisionbasicnessmallmanualcharles macdonaldtoshiya takedatvmidistellaimageshandheldgp32to7museumgallerysc-3000frodofujitsuapple 2kigbconverterstoryremakeapplepasopiafinal burnn64solutionsversionsmultifaceandroidmaking ofemulationdescentarcadiacivilizationguidegermany8-bitmo6pcsxgamecubeti-92rzxcolemfamtasia3d realmspointlesstrailblazerrom hackusromspc enginestudio 2muledoomgizmondoatomarstechnicazx80jumpmantechnotesti-89little johnfmsxz-codegradiusqnxmo5gameszorkamigacollectionwolfenstein 3dto8docspokesinfocomhucunmaintainedfreebsdapple 2gsvirtual boyprogrammingqlnesps2adventure gamesfpgagifastrocademastergearpsionopenglanalysisc128atari 8-bittoolchainmega drivedebuggerzaurusnintendomz-700pc-6000dtvcreatorsnewslettersboycott advanceharvestkegstosstreamingpluginoricwonderswanneopocottvaxapple 1tnkmaemongpsmartphonesharppreservationultima65816i18nscansarticlepdfinterviewemulatorsj2mebeebgcctaitocommercialbox shotsarcadetimelineitalyos/2magickitclubtoshibaunixwiztriviagermanmagnetic scrollssonicff7ralph baersolarismasterneo geobard's talereviewsscott adamsx86tcp/ipindiana jonesabandonwaresgbscummvmchronologypom1peoplenvgartworkdnacultureebayibm pccpcdatabasepalmosseriesmoviesschematicskim-1rom hackingllamasoftmailing listcastawayspecscommander keenquotesviceaction replayifcalculatorexcerptron gilbertkonamiyoutubedingooluxorinterpretersformatsjavaadswalkthroughspasswordscompilercharacterscopy protectionconsolespsfonline playfm townswinuaeinterpreterradiotranslationsmike daillynecmsxresourceslisajum52ssempandorafcemark3amstradgbausenetcommodoredownloadszopharmaniac mansioncp/matari 7800game geararticlesdragonfirmwarefolkloretype-indreamcastgame designgp2xconverterszx spectrummarat fayzullinmagazinerisc ospinoutsbugslinksagiatari stgnuboyaltairemulatortutorialsftpsupervisionjapantandymonkey islandtutorialsovietlucasartswalkthroughmesscensorshipgithubfdsremixesfinal fantasydemosbasicpc-fxbookcomputerscasioplus/4toolshugues johnsonmacmusicdemo sceneneo4allarchivedshopcompatibilitysnkdiskmagscompressionsidinfoneszx81thompc-88handybluemsxx1recompilerlost sourcedemodma designmanualsstrategygp2xpectrumpcwxzxpaul robsondumpingintroductionhistoryadamx68000screenshotsrom hackspocketpccompilations6502atari800genesis plusdosboxgame boyoperating systemsymbianarmdarcnesreferencenesterhomepagefan gamesbiographyosf/1mapscodefanzinerom listingssoundtracksmac pluspv-1000snes9xacornwindowscolecovisionneopopiossmsnetworkingnewselectronendingsddjforumarnoldid softwarewiirainbowatari stefan fictiontoolshmuppsxboulder dashgbcedgeencyclopediaelitecomicspodcastcomposershitchhikergamefm-7powerpccartridgenet yarozeaixteosfcfusevideoascii artwinampcomputergeneratorcomputingsaturnarchivecartridgesonlinedavid foxgplvcsukhead over heelsmz-80underdogsfeaturesam coupĂ©sierradelphigeocitiessdkcreativisiongiana sisterswscblogmarcel de kogelrick dangerousfan artxm6faqsrichard bannisterassemblerreplicasfrenchspace invadersguidesepsonsnatcherinstallersjrpgsmastertronicsms plusgamasutralibrarymz-800jupiter acebioscps2mupenbbc basicsf-7000rpgspetodyssey2spectravideop2000cocodott32xcd32uaejeff minterlynxpiratestrs-80coversik+sdlhumorcompetitioniac16hpmac ossoftwareitdatasheetsmtxhardwareretrodevfrancegremlinchi-scoreslinuxheretic