opengl

link thumbnail Andre' Werthmann`s -Homepage-
Linux port of both the software renderer and OpenGL versions of Heretic.
(Added 2003-11-12, 476 hits, more)
link thumbnail asylum.acornarcade.com

SDL Asylum is a C port of the computer game Asylum, which was written by Andy Southgate in 1994 for the Acorn Archimedes and is now public domain. It should be possible to run it on any platform which support SDL and OpenGL graphics. It's developed primarily on Linux but has also been built successfully on Cygwin, FreeBSD, Windows and Haiku.

SDL Asylum is currently li ...

(Added 2007-09-10, 627 hits, more)
link thumbnail D2X-XL
Descent 2 is a pretty old game, and further development has slowed down; so there are a few issues - some still stemming from the original Descent 2 - that have never been adressed or solved in D2X.
As I still like Descent 2 pretty much, I was always looking for a way to get rid of the things that plagued me most in Descent 2. Getting hold of the D2X source files and being abl ...
(Added 2012-10-11, 243 hits, more)
link thumbnail DXX-Rebirth - The classic Source Port for Descent and Descent 2
DXX-Rebirth is a Source Port of the Descent and Descent 2 Engines for Windows, Mac OS, Linux, offering OpenGL graphics and effects, many improvements and new features.
(Added 2012-10-11, 292 hits, more)
link thumbnail EDuke32
It's time to kick ass and chew bubble gum, and I'm all outta gum!
The most advanced version of Duke Nukem 3D available. For Windows, Linux and OS X, supports OpenGL and has hundreds of new features. Come get some!
(Added 2012-10-11, 272 hits, more)
link thumbnail Oolite
Oolite is a space sim game, inspired by Elite, powered by Objective-C and OpenGL, and designed as a small game that is easy for users to pick up, modify and expand upon. Almost every aspect of the game can be changed by using simple, free graphics packages and text editors.
If you ever felt that Elite should have this or that feature, there's a pretty good chance that the ...
(Added 2006-02-10, 408 hits, more)
link thumbnail QuarkTex
Accelerated 3D for Amiga software running in WinUAE.
QuarkTex is a 3D graphics hardware virualization solution first released in 2003. It transforms calls to the Warp3D API inside an emulated AmigaOS to native OpenGL calls for a host Windows system.
(Added 2007-11-04, 489 hits, more)
Search:

Tags

downloadssnes9xrom hackshexengcctaitoepsonkigbgbccharles macdonaldscansarticlesneo geofinal burnsierraschematicsneopopcartridgemonkey islandacademicharvestgnuboywonderswanabc80online playmagnetic scrollssovietcompetitionpowerpcgp2xintellivisionsam coupĂ©computerssmartphonedma designbugsosxtype-increativisionaixuaewinuaeoperating systemlittle johncalculatorgeneratorukbiosboycott advancemupentechnotesshopwalkthroughsradioresourcesshmupssmsjavaamstradheretictimelinedosboxcpcwolfenstein 3dintroductionbooksjrpgstreamingconversionmastertronicfan artencyclopediapalmoshpx68000fcesega cdarchivedsupervisioncolecovisioncommodorekegsthomprogrammingreferencewinampversionszorksquaresoftmanualsftpsnatchergremlinwscstoryi18nzx80podcastinterpretersoundrainbowhitchhikerremixespc-88messfan fictiontcp/ippsfhumorreviewsxm6interviewslinksssemgradiusfpcefaqstutorialadamxzxemulatorsassemblermagazinexboxpiratesflashhomepagesnkti-92nintendoteotutorialsmacmusicultimapublisherpointlessmultifacegermanpatchescaanoopc engineibmdtvclonesdatabasebabyspainfuse68kcopy protectioncp/mreplicasarchiveapple 2pc-98pc98pocketpccompilersgbxgsadventure gamesgamasutrablogvicegame designsinclaircoversjumpmanbo zimmermanhandydemomidiagienginestellangpcjapanzx81idenet yarozepinoutsstrategyvcsdownloadartworksaturngamecubemasterlinuxastrocadegiana sistersspectravideoplayerscasioiapasopiamo6studio 2id softwarebeebcatalogdebuggerascii artwalkthroughvaxdocsbeosquasi88quotescommercialos/2mz-700qnxgraphicshead over heelsbenj edwardsremakesseriesbluemsxtrs-80windowsfaqnsfarcadiaretrodevscorpionarmdavid foxunmaintainedlost sourcemo5mp3sonyik+photospreservationitalysimcoupepc-fxflyersshmupneopocottatariopenglvideoszx spectrumincompletedescentmailing listaltairauctionsdatasheetsuae4allfrancevirtual boynewslettershandheldti-89toolmarat fayzullinanalysiscodemsx6502flashcartsjaguarfmsxitsolutionsx1frontierbox shotsmipspsxcollectionolafnesformatszophardemo scene65816infonesmega drivedoomcolumnselectronfellowgizmondoconvertercopiersj2memamesg-1000delphielitehintsnestnkscreenshotstrailblazerunixgame boymaniac mansionscummff7ddrsfcphilipsgameinterviewwindows cecps2amigandsarcadechronologysharpmega manaction replaygp2xpectrumatari stculturevbaron gilbertmike daillyfolklorec128videofrenchnewsapple 2gspom1martin korthfm-7fm townssdkcamputers lynxmastergearwikimz-80libraryfdsps2tandycomposerstoshibangcdopen sourcesdlspecsfamtasiamuseumunderdogsx86dreamcastsharewarerom hackz80mapsjupiter acecivilizationdottoricllamasofthistoryromsp2000scott adamsspace invaderscheatsneo4allnewsletterspritesatari 7800asciiartpentagonsource codemediahardwarediskmagsfujitsuporttoolssoftwareconvertersgifcocoforumguidepv-1000indiana jones3doxm7final fantasyrom hackinghugues johnsonarticletoscompilationsiosms-doswiisc-3000gamebasegame gearimagessf-7000bard's talenec.netvectrexfpsemac plusduke nukem32xsolaristhalionpluginfpgaussegaadssunossmallpcsxcreatorsmz-800frododingoolucasartsatari800freebsdgplpokesodyssey2risc osvisual basicrpgmarcel de kogeltranslations3d realmsdnacomicsvgblynxapple 1mark3androidunreleasedrpgscd32atari stepcwlisacompressionmtxn64wizmetal gearchip8cd-idemoscomputing8-bittoshiya takedacompatibilityusenetsonicc64atari 8-bitcommander keenrick dangerousvic-20jeff mintermerchandisehi-scoresbbc basicbookrzxmulecapcomdumpinginstallerscensorshippsionmagazinesdragoncifguidestgemupdfjapaneseralph baerluxorcharactersendingscastawayebaygenesis plusjswarnoldgamesmanualzaurusmodsarstechnicaemulatorinterpreterspc-6000emulationpspclubpetto7githubpandorabiographynamcorotttvfan gamespeoplejum52mac osbasicremakeatomz-coderom listingscomputertoolchainbbcapplemaemoaquariusgeocitiesmagickitvideo gamesboulder dashinfocomcolempasswordssms plusmaking ofsymbianibm pcedgejrpgsapogeepaul robsongbagallerynestergrim fandangogp32soundtracksfirmwarearchimedesscummvmnvgwikipediaacornhucqlngprichard bannisterti-99/4aspace questosf/1to8germanynetworkingadventure gamecollectingbasicnesyoutubefeatureplus/4c16onlinerecompilerkim-1darcnesconsolesscimoviestriviakonamiexcerptcartridgesatari 5200abandonwareddjsidfanzinecpu