open source

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 >   Next Page >>
link thumbnail TOK64
DOS tool converting ASCII text listings into binary tokenized programs suitable for running on a C64 or emulator.
[Also available on github.]
(Added 2008-01-15, 326 hits, more)
link thumbnail Tower Toppler ende
SDL-based Nebulus clone for several platforms
(Added 2006-02-10, 208 hits, more)
link thumbnail TuxNES
[A]n emulator for the 8-bit Nintendo Entertainment System. Currently, the emulator has been tested on Linux, FreeBSD, and NetBSD, all running on i386 processors.
[...]
TuxNES is based on Nestra, a great public-domain NES emulator by Quor.
(Added 2003-11-12, 337 hits, more)
link thumbnail UAE4ALL
Port of Amiga emulator UAE for Sega Dreamcast and Dingoo. Versions for Windows and Linux are also available.
(Added 2006-08-30, 368 hits, more)
link thumbnail UAE4ALL Gizmondo Port
Port of Amiga emulator UAE4ALL to the Gizmondo.
This version shares the same codebase as uae4all gp2x 0.6.3, including the FAME/C core that the mighty Chui provided. Sound works now.
(Added 2006-08-30, 551 hits, more)
link thumbnail uae4all gp2x
Port of Amiga emulator UAE4ALL to the GamePark GP2X.
(Added 2006-08-30, 720 hits, more)
link thumbnail uBee512
Open-source Premium Microbee 512K FDD emulator for Windows and Unix.
uBee512 emulates all of the Microbee Z80 series of microcomputers, including ROM, Floppy and Hard disk-based models. Up to 2MB of extended memory is supported. The optional on board sn76489 sound IC is also emulated. The display may use SDL or OpenGL video rendering. Z80 PIO emulation includes tape, speaker, RTC, ser ...
(Added 2007-08-27, 211 hits, more)
link thumbnail UberNES
NES emulator for Windows with hi-score tracking, advanced ROM browsing, debugger, and other features.
[The GPL'd and highly portable emulator core source code used to be available for download here, but has since been removed. It can, however, still be found at the Internet Archive.]
(Added 2006-11-25, 174 hits, more)
link thumbnail uli/huc · GitHub
Enhanced version of the PC Engine development system HuC.
By this author.
(Added 2014-11-17, 1104 hits, more)
link thumbnail uNESsential
Unmaintained and incomplete NES emulator written in QuickBASIC.
(Added 2006-11-26, 201 hits, more)
link thumbnail unofficial nester
NES emulator for Windows based on nester with some added features.
[Source code is included in the binary download.]
(Added 2006-11-26, 325 hits, more)
link thumbnail Unreal Speccy
ZX Spectrum/Pentagon emulator for Windows.
(Added 2006-09-22, 315 hits, more)
link thumbnail uosnes ja translate
Enhanced version of Snes9x for Windows and Linux emulating a Super Famicom with the Bandai Sufami Turbo accessory.
(Added 2007-06-12, 884 hits, more)
link thumbnail UQLX
Sinclair QL emulator for X11.
UQLX is a software emulator emulating a Sinclair QL on Unix/X and similar systems.

UQLX is now in late alpha stadium, it deals very well with most QL software and works on most Unix-like architectures. Emphasis is to achieve useful integration of modern QDOS into Unix/X environment but also runs many old games.

...

(Added 2003-11-12, 349 hits, more)
link thumbnail UZIX enpt
An open-source Unix Implementation for MSX computers.
(Added 2006-08-17, 178 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 >   Next Page >>
Search:

Tags

harvestcompilationsukdatasheets3dogizmondothompom1open sourcex68000boycott advanceimages3d realmscensorshipdownloadneo geozx81italyhandymega manmsx68kn64rottmtxgeocitiestaitoi18nusenetabandonwarediskmagsneo4allhumorftpdtvsgbexcerptpodcastfan artsymbianti-99/4agame designmerchandisesource codefreebsdinterviewsartworkcartridgesvcsanalysisngpsfcpspwinampchip8sonyhandheldfamtasiacapcomnetworkinggeneratorarchiveinterpreteridevideo gamesfdsjupiter acemulecollectingspace invaderspalmosformatsvbafranceunmaintainedadsxm7hugues johnsoniawizqlcamputers lynxduke nukemsc-3000remixestutorialacornpdfsdlgp2x.netbard's talesonicpc engineshopgbcllamasoftff7gp2xpectrumpatchesx86magazineplus/4converterscd32dreamcastsquaresoftdma designflashuae4allromsguidesguidecoverscodefpcewindows cespecsdemolynxcommodoregamebaseamigatranslationsarnoldtvzorktoshibabluemsxpocketpcjapancomputersmultifaceremakedemosnesebayunreleasedmz-700tcp/ippc-6000gamasutracharactersgame boydocspublisherencyclopediasimcoupeonlinedelphihintsarchimedesbox shotssms plusatari 5200benj edwardsos/2odyssey2cocosupervisionps2forumgp32ti-92pentagonstellaemulatorstnkdarcnesmastertronicscummfrontierarticleshead over heelshardwarevideosremakesfan fictionabc80hitchhikerzx spectrumcartridgepowerpccpcdumpingscorpioninterpretersspace questasciiartzophar32xitmike daillycompatibilityfirmwarerick dangerousifvisual basicsmartphoneconversiontoolsinclaircopy protectionstrategymagickitbasicnespokesgremlinnewslettermastermz-80dingooluxorpasopiatospv-1000tutorialslinkscommander keenmapsplayersmagnetic scrollsjaguarnet yarozeto7vic-20plugindoombiographymastergearadammark3pcwclubbookatari 7800wolfenstein 3dwalkthroughsfpsevgbc1288-bitgalleryqnxti-89jeff minterkim-1bbc basiccomposerspinoutsdownloadsauctionssidphilipstechnotesndsatari800virtual boydescentpreservationfm townsonline playpaul robsontype-innamcopc-88endingsgplsnes9xuswalkthroughunderdogsfinal burnmp3vicefaqcreativisionfellowpc-98wonderswanmo6tgemucompilerjumpmancreatorsmacboulder dashagipc98windowstimelinerom hacksjapaneseddjcivilizationp2000mamearticleatomhucosxneopoptoolsgrim fandangoretrodevsolutionsmartin korthadventure gamerzxsdkspainquotesmetal gearlittle johnoricreviewsindiana jonescps2incompletesmallgermanvectrexfan gamescollectionc16sierrafolklorebugsxm6epsonms-dosfeaturephotosrom hackingzx80mega drivegithublibrarymoviesmonkey island6502edgesolarispeopleddrshmupssunosmaniac mansionarmmusichomepageseriesx1ik+psxpasswordsjswcomicsaquariustriviaultimamarcel de kogeljrpghereticportnsftrs-80fcegermanyc64midigiftoolchainmuseumhexenunixflashcartscd-iblogfmsxscigamepcsxjum52pc-fxdatabasefusebasicgnuboyfpgamac oshpascii artsoundtrackscolecovisioncompetitionmanualrainbowxzxschematicsmac plusandroidmupenteonewslettersjrpgsreferencepiratesapogeeelectronacademicinstallerssnatcherralph baermanualsibmsovietchronologystudio 2magazinestoshiya takedamarat fayzullinconsolesthalionnintendoversionswscpsffaqsrisc oscastawaycasiographicsj2meapple 1ron gilbertarcadesaturnsf-7000copiershistoryscott adamsemulatorquasi88programmingsmsarstechnicascreenshotsdavid foxopenglatari 8-bitengineaction replaysoftwareintroductionbbccp/mibm pcmailing listwikipointlessolafnessharpcolumnscheatsrom hackcataloglinuxbeosstreamingfrodoeliteshareware65816storymaemocolemcmodscpurpgfinal fantasybabysg-1000emulationngpcdnaadventure gamesatari steassemblerwiimo5lost sourcegame gearrom listingswikipediaastrocadespectravideogradiusgiana sistersnecwinuaegbashmupvaxgamesrichard bannistermessspriteskegsinfonesataricharles macdonaldkigbappletrailblazerid softwarelisabeebdottuaez-codecompressionsoundnewspandorangcdarchivedkonamirecompilermz-800dragoncomputingaltairdosboxamstradfujitsuconverterbiossegaoperating systemjavascansbooksclonesreplicasz80flyersfm-7debuggerhi-scoresssemcaanooresourcesarcadiagenesis pluscultureinterviewatari strpgszaurusosf/1intellivisionapple 2gsiosyoutubelucasartssnksega cdapple 2scummvmnesterdemo scenebo zimmermansam coupépetvideofrenchneopocottaixmaking ofpsionxboxcalculatorcomputertandynvgradioto8fanzinexgsinfocomgcccommercialmipsmediagamecube