open source

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 >   Next Page >>
link thumbnail AndrewK / Napalm : PSX
Some old and crusty PlayStation development tools with source code.
(Added 2003-11-12, 395 hits, more)
link thumbnail Apple 1 Project enfr
Hosts several Apple I emulators, most notably Pom1.
(Added 2003-11-12, 507 hits, more)
link thumbnail Apple Disk Transfer
ADT is a set of open-source programs used to transfer 5.25" disk image files between a PC and an Apple II whose serial ports are connected by a null-modem cable. Disk images saved on the PC can be written directly to a floppy disk in the Apple II drive and a floppy disk in the Apple II drive can be saved as disk image on the PC.
(Added 2007-09-06, 501 hits, more)
link thumbnail AppleCommander
Open-source Java tool to move data between Apple ][ disk images and a native filesystem.
(Added 2003-11-12, 361 hits, more)
link thumbnail Applelet
An Apple ][ emulator implemented as a Java applet. Source code only.
My unhealthy fascination with Apple ][ emulation continues, this time with a Java version. MSIE's VM was the top performer last time I tested, but I imagine HotSpot will make this thing seriously cruise. You should be able to get at least 10 FPS out of it.

I have made the source code available for your p ...
(Added 2003-11-12, 443 hits, more)
link thumbnail AppleWin
Apple IIe emulator for Windows.
(Added 2007-09-04, 393 hits, more)
link thumbnail Arachnoid
Open-source graphics plugin for Nintendo 64 emulators under Windows.
(Added 2007-08-15, 488 hits, more)
link thumbnail ARAnyM
virtual machine software for running the Atari ST/TT/Falcon operating systems and TOS/GEM applications.
ARAnyM is a software virtual machine (similar to VirtualBox or Bochs) designed and developed for running 32-bit Atari ST/TT/Falcon operating systems (TOS, FreeMiNT, MagiC and Linux-m68k) and TOS/GEM applications on any kind of hardware - be it an IBM clone (read it as "PC" :-), an A ...
(Added 2003-11-12, 474 hits, more)
link thumbnail ArcEm
Archimedes Emulator for Unix and RISC OS. Open-source emulator of an A400 series machine. An emulator project that simply refuses to die, its ten-year release cycle notwithstanding.
(Added 2003-11-12, 421 hits, more)
link thumbnail Aspectrum Emulator enes
Another Spectrum Emulator. Portable emulator for MS-DOS, Windows, and Linux.
(Added 2006-08-07, 498 hits, more)
link thumbnail asylum.acornarcade.com

SDL Asylum is a C port of the computer game Asylum, which was written by Andy Southgate in 1994 for the Acorn Archimedes and is now public domain. It should be possible to run it on any platform which support SDL and OpenGL graphics. It's developed primarily on Linux but has also been built successfully on Cygwin, FreeBSD, Windows and Haiku.

SDL Asylum is currently li ...

(Added 2007-09-10, 620 hits, more)
link thumbnail Atari800
Atari800 is an Atari 800, 800XL, 130XE and 5200 emulator for Unix, Amiga, MS-DOS, Atari TT/Falcon, SDL and WinCE. Our main objective is to create a freely distributable portable emulator (i.e. with source code available)
(Added 2003-11-12, 553 hits, more)
link thumbnail Atari800Win Plus enpl
Atari 8-bit emulator for Windows.
(Added 2006-09-03, 578 hits, more)
link thumbnail Atomac
Acorn Atom emulator for MacOS Classic (PowerPC). Source code available.
(Added 2006-08-17, 396 hits, more)
link thumbnail B-EM
Open-source BBC Micro emulator for Linux and Windows. DOS and Mac OS X versions are no longer available.
(Added 2006-07-15, 356 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 >   Next Page >>
Search:

Tags

historyti-89operating systemconvertersintellivisionexcerptvisual basicspace invaderssolarismastertronicz-codewalkthroughsoricquasi88mo6luxorxm6compressionsupervisionsquaresoftacademicassemblerbiographygradiusfan fictionrom listingsatari steblogvaxandroidpc98atari 7800pcwbard's taleatomsaturnfujitsucensorshipjeff minterformatsmidijrpgssnkspace questvic-20magazinesconversionascii artaixabandonwareplugingeocitiesfinal fantasynecuaedemo scenemz-80compilationsdownloadfpcep2000kim-1dumpingralph baerpatchessmallresourcesreplicasstrategysmartphonegamasutrauae4alli18nstellaculturemp3japanesegplbookapple 2gsgp2xpsxpc enginepetusenetpentagonmapsvcsgamebasetoolsmsxmetal gearnet yarozewindowsmailing listflyersepsonclonesunixrick dangerouspdfcapcomneszx81downloadstoshiya takedachip8demomaniac mansionatari stifmark3frenchemulatorspasopiababyc64mega mannintendoarticlesnester3dorom hackingindiana jonesrisc oshardwarearchivedthomatari800homepagepandoraengineneo4allfrodoaction replayzorkodyssey2abc80fpsetimelinehandheldbbcidecompetitionneopocottpowerpccp/mrom hackz80ngppsparstechnicaretrodevgbcpalmoskigbedgengcdhintsendingswolfenstein 3dspainmipscoverslittle johnarnoldmega drivesidarchivefreebsdcollectingcatalogwinuaedragonlinkssnes9xpasswordsdosboxopen sourcezopharaquarius68kkonamibeebmo5iasoundtracksc128fdsndsmuseumcamputers lynxvideoik+scummromsboulder dashjswjrpgcompatibilitymulehandydescentsg-1000box shotsff7kegstranslationsadsgallerywiz.netultimasegacompilermusicadventure gamemz-800codeinterviewsgp32remakecommercialunreleasedbenj edwardsmactoolartworkdemosportcalculatorharvestsharp65816game gearjumpmanngpcron gilbertgremlinx68000hexenamstradarchimedesspectravideoxzxtgemumartin korthcolecovisionnewsletterto8arcadelibrarypcsxitalysdkfaqscharactersgraphicswalkthroughfellowastrocadeauctionstvintroductionpreservationcastawayreviewsdottsierraconverternewscommander keenfusebluemsxhead over heelsamigams-dosid softwareremakeshitchhikerjupiter acetechnotestrs-80gbaarmsam coupĂ©doomx1magickitemulationversionsrpgfm-7playersto7recompilerps2cdebuggerpointlesstaitovbamultifaceadventure gamestnkmarcel de kogelcpulucasartsinstallersdelphisoniclisashmupopenglsharewarespritesforuminterviewdtvatari 52006502comicswiirainbowmamevgbfrancednasimcoupehugues johnsonfolkloregermanyradiotriviajavaapple 1gp2xpectrumgifneo geodocslinuxzx spectrummagazinesovietphotossoftwarecocoddjtutorialpiratessc-3000osxscummvmfeaturecpcanalysisagichronologybugsqnxpodcastgithubc16fcefinal burncharles macdonaldonlinehereticbeosscanscolumnshumorsms pluswindows cezaurusgermanatari 8-bitmanualsf-7000fanzinepeopletrailblazerincompleterom hacksftpsoundspecsos/2tutorialszx80apogeecopy protectionprogrammingmanualsshopibm pcguidesfaqdatasheetsgeneratorcivilizationrpgspokesolafnesgrim fandangowscvideo gamesunderdogsvectrexrottssemfmsxdarcnesgnuboyn64messebayscigizmondohi-scoresmonkey islandqlflashvirtual boyconsolesdiskmagsibmpc-98screenshotsnewslettersshmupsyoutubestudio 2symbiannamcoapple 2dma designfpgacolemj2meplus/4game3d realmssnatchermovieswikipediapublisherreferencegiana sistersduke nukemsolutionsosf/1wonderswanguidesgbbbc basiccomputerelitebasicnesgamecubejum52articleapplepv-1000pc-fxbooksarcadianvgcps2interpretersstorycomposersnsf32xfrontierinfonesclubmodsdreamcastcomputingmupenflashcartsseriespsiontandymastergeartcp/ipsource codevicebiosmike daillyxgsjapan8-bitxboxhucscorpionschematicswinampcomputerspocketpcnetworkingiosfan artsega cdacorngccgamesatarimarat fayzullinpom1electronlost sourcelynxscott adamsfm townsmagnetic scrollsinterpretercollectioncartridgessunosmerchandiseti-92genesis plusrzxsinclaircopiersmastermaemofamtasiasonymac oscd32fan gamesx86boycott advanceremixesrichard bannistercreativisionxm7mac plusemulatorphilipsdingooinfocommtximagespaul robsonbo zimmermangame designuksfcasciiartmz-700pc-88encyclopediacheatscasiojaguarvideosunmaintainedthalionmaking ofquotessdlwikidavid foxneopoppsfbasicdatabaseadampc-6000ustoshibafirmwarellamasoftcaanoostreamingti-99/4ateoonline playmediacommodoreitcd-itoscartridgesmstype-inaltairpinoutsgame boyhpddrtoolchaincreators