nes

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 >   Next Page >>
link thumbnail Low Level, The
Brian Provinciano's source for Nintendo NES, Game Boy, and other console hardware and software development, game obscurities, disassembly, and other random material.
(Added 2007-10-10, 236 hits, more)
link thumbnail MadNES
Incomplete NES emulator for DOS.
MadNES supports a decent number of mappers, but has primitive sound support. It also has preliminary lightgun support and joystick support. It's about average.
[Web site not in Internet Archive due to robots.txt exclusion; entry points to emulator archive at Zophar's Domain.]
(Added 2006-11-22, 284 hits, more)
link thumbnail MadNES, ARCNes (Acorn NES Emulators Homepage)
MadNES:
This is a port of Roberto Rosario's NES emulator, it is quite nice and is very accurate. It is being developed readily and thus should be a nice addition to the Acorn emulation scene! This emulator thus replaces ARCNes!
[...]
ARCNes:
You can still doownload this emulator, which will no longer be developed!
(Added 2012-10-08, 130 hits, more)
link thumbnail ManiacNES
NES emulator for Windows. [Downloads have not been archived. Get the last release at e-lation.net.]
(Added 2007-06-11, 241 hits, more)
link thumbnail Marijuanes
NES emulator for Windows.
marijuanes appears to be a fairly new emulator from the author of Squeem with minimal mapper support and partially working sound. It may get better.
On the other hand, it probably won't.
[Entry points to emulator archive at Zophar's Domain.]
(Added 2006-11-22, 341 hits, more)
link thumbnail MarioNES/80five
NES emulator for Windows written in Visual BASIC.
(Added 2006-11-21, 299 hits, more)
link thumbnail NES Central
Still playing with power! NES game database, NES games for sale, news and links.
(Added 2007-01-14, 379 hits, more)
link thumbnail NES Emulators (Zophar's Domain)
Provides a number of NES emulators for download that do not have their own web site (any more), such as FE, NE, Nofrendo, Squeem, Little John NG, WiNES, etc.
(Added 2006-11-26, 345 hits, more)
link thumbnail NES Enshrined, The
An NES shrine with a unique style.
(Added 2007-01-15, 235 hits, more)
link thumbnail NES Reproduction Sale
Sells unreleased NES games on cartridges. Legally questionable, if you ask me, but then, what isn't these days...
(Added 2007-10-29, 329 hits, more)
link thumbnail NES Specifications
Detailed NES programming reference by Martin Korth.
(Added 2006-10-23, 341 hits, more)
link thumbnail NES Tech FAQ
NES Technical/Emulation/Development FAQ. Answers the questions about the technical side of the NES/Famicom, NES emulation, and NES development, which are most frequently asked by people curious about their NES system.
(Added 2008-04-11, 188 hits, more)
link thumbnail NES World
Your source for NES information. Accessories, prototypes, game reviews, articles, interviews, lawsuits, pirate carts, ads and commercials, posters, box art, hints, cheats, and codes, manuals, and much more. Archived web.archive.org.
(Added 2003-11-12, 361 hits, more)
link thumbnail Nes-Lord
NES emulator for DOS.
An emulator based on NESA, this emulator, written by CHECK, has not been updated in a long time. There's no sound, and it supports only a few mappers. Don't waste your time with this one.
[Entry points to emulator archive at Zophar's Domain.]
(Added 2006-11-23, 377 hits, more)
link thumbnail NES496
Incomplete NES emulator/debugger for Windows.
This NES emulator was coded as a result of a college assignment in CSE496, hence, the name NES496. It uses DirectX for drawing the graphics. It has partial sound, is rather slow, and only supports a few mappers. It does, however, have a cool graphical debugger. It's not really worth the download right now unless you want to play with the d ...
(Added 2006-11-23, 371 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 >   Next Page >>
Search:

Tags

lisabiographycommander keenpointlessrom hackinghead over heelspc-88piratesindiana jonesmastertronicclubrzxunreleasedfinal fantasybenj edwardshexenunixosxsg-1000interpreterstype-invcsretrodevrom listingselitecapcomfpcecommodorekegsrottfanzinecopiershardwareusenetti-99/4adavid foxjeff minterdarcnessdlsam coupĂ©doommega manvisual basicsgbpasopiatrs-80civilizationtrailblazeropenglwalkthroughssmartphonedosboxsharpvbaunderdogsmasterngpemulatorsarchivewindows cehumorquasi88flyersthomcp/maction replayfdspc-98academicgplvgbcompilerspectravideoonline playremixescolem6502windowsunmaintainedfusetgemuddrmaniac mansionjupiter aceatomteoadssierraxm7peoplessemsnes9xcoverscharles macdonalduschronologyvaxagigradiusfrancegiffamtasiamapspom1dragonspecsenginesnatchertranslationsodyssey2monkey islandidedma designmacsdkshopconsoleshuccharactersdocsz80featuretaitozopharscummsimcoupefinal burnfan gamesps2emulatorllamasoftdatabasespace invaderstutorialapple 2gsff7mailing listfujitsuemulationgenesis plusanalysisrichard bannisterdreamcastmac osexcerptc16gamepdfarticleinfonesschematicsbox shotspcwsfckigbscreenshotshandymark3faqvirtual boycps2x1toshiya takedanewsmike daillycompilationsasciiartbluemsxintroductionpreservationwikipediavic-20fan artcommercialbo zimmermansolutionsclonesepsondownloadsqnxfreebsdluxorchip8portmupenstreaming68klibrarycolumnsgalleryreferencehpstudio 2newslettersversionsarnoldpspconverterinterviewzorkralph baertriviahistoryx86pokesabandonwaremidicodeatari800spaincompressionarcadegame boymp33d realmspatchespsfbiosngpcgamecubex68000lost sourcejaguarioswiiremakeswolfenstein 3dsmallpentagonopen sourcebookscartridgesstrategydelphineo4allsinclairgermanyzx80jumpmantoolchainrom hacksbbcmediasmsebayarticlesmartin korthfpsedemoosf/1pc-6000c128xgsscummvmiaarstechnicandsmulemamejapanesespriteswinuaeconvertersjapansega cdarcadiaxboxbeebpetassemblerprogrammingdottmerchandiseto7blogyoutubesc-3000boycott advancejswsms plusvideo gamesjum52pinoutsddjwonderswandumpingcomputersshmupnetworkingartworkscott adamsoperating systemcaanooresourcesadventure gamesgccpasswordsfaqswizsidguidesvideosgithubromsapplengcdduke nukemforumj2meauctionssoundtracksintellivisionmagickitkonamimz-700little johnsonynsfmanualsgnuboyrom hackcamputers lynxultimaascii artmtxtoshibaifcukadamaquariusmarcel de kogelnintendorecompilerfrontierzx81altaircollectionwinampi18ndingoonvg3dogamesfolklorebasicnesgraphicsfirmwaregame gearitalyzx spectruminstallersfm-7encyclopediareplicasti-89c64endingsron gilbertitnet yarozehi-scoresneopocottcreativisionandroidgeneratortcp/ipdemosfellowjrpgwikidatasheetstimelineimagesfmsxmuseummultifacemo6hugues johnsonmsxcopy protectionshmupsinterpreternamcorainbowinterviewsbard's taletandysolaris32xmega drivemessoricmusichandheldmac plusbbc basicflashcreatorssoundphilipsrpgssovietincompleteadventure gamepsxbabytooluaeatari 5200fm townsibmsymbianformatsgizmondotnkmagazinesgp2xphotosgamebasesaturncpugrim fandangorpgms-dospaul robsonpowerpcxzxpocketpcculturednajrpgsrisc oscensorshipvideopublishersource codeftpneo geop2000apple 2ik+colecovisioncomputersf-7000mz-80vectrexuae4allcastawayaixos/2gp2xpectrumid softwareapogeegbcgeocitiesatari stsnkfrenchcasiogame designspace questtvcatalogtechnotesatari 8-bitsharewarelucasartsdiskmags.netradionestercomputingastrocadebasichomepagecomposersboulder dashti-92quotesmarat fayzullinconversionmagnetic scrollsacornmodsnewsletteramstradmipsatari stemaking ofpv-1000xm6supervisionkim-1pcsxtoscartridgewscmetal geardtvgp32maemoedgedownloadcd-icheatspodcastpluginseriescompatibilitygiana sisterslinksbookqlfpgademo sceneplayersharvestlinuxgremlinlynxnesscorpionelectroncollectingn64frodoarmbugsibm pcpc-fxstellabeosrick dangerousmz-800fcepalmoscd32squaresoftscansmagazineinfocommanualthaliontoolsneccompetitionpandorasegagamasutracpcscihereticstorysonicremakecomicsdebuggermastergearsoftwarecalculatorpc98reviewsapple 1abc80fan fictionataridescentolafnes65816gbaguidez-code8-bitarchimedesvicewalkthroughatari 7800cocozaurusto8amigamo5neopoppsiongermanhitchhikersunosmovieshintsarchivedplus/4onlinepc enginetutorialsjavaflashcarts