nes

1 2 3 4 5 6 7 8 9 10 11 >   Next Page >>
link thumbnail Romhacking.net cool hot
Comprehensive translation and ROM hack database and news site. Also features an abundance of programming information for many console platforms, with an emphasis on NES and Super Famicom.
(Added 2005-12-27, 4375 hits, more)
link thumbnail FCE cool enja
Incomplete open-source NES emulator for DOS that served as the basis for many other NES emulators.
Why I make NES emulator where many many emulator are available? I want to port NES emulator to PlayStation,but I can't find Portable C source except xNes,it is too slow for PS on R3000/33Mhz. so now I'm making NES emu for DOS/VGA first. My last target is PlayStation with portable code, s ...
(Added 2006-11-21, 584 hits, more)
link thumbnail FCEUX cool
FCEUX is a Nintendo Entertainment System (NES), Famicom, and Famicom Disk System (FDS) emulator. It supports both PAL (European) and NTSC (USA/JPN) modes. It supports both Windows and SDL versions for cross compatibility.

The FCEUX concept is that of an "all in one" emulator that offers accurate emulation and the best options for both casual play and a variety of more adva ...
(Added 2003-11-12, 1061 hits, more)
link thumbnail GameTronik cool fr translate
Great video game archive featuring complete sets for many vintage computer and video game consoles, including some CD-based systems. Fast downloads. Also has gameplay videos, articles, French TV clips, a comic, and more.
(Added 2008-04-15, 1748 hits, more)
link thumbnail higan cool
Formerly known as bsnes.
higan is a Nintendo multi-system emulator that began development on
2004-10-14. It currently supports the following systems:
  • Famicom
  • Super Famicom
  • Game Boy
  • Game Boy Color
  • Game Boy Advance
  • Nintendo DS
higan also supports the following subsystems:
(Added 2007-08-15, 1015 hits, more)
link thumbnail NES emulator cool
Bisqwit's open-source NES emulator is the pinnacle of incomplete NES emulation: it doesn't even have video output.
(Added 2007-10-29, 588 hits, more)
link thumbnail NesDev cool
An abundance of Famicom/NES programming and hardware documentation (including 6502, FDS, and cartridges), lots of sample code, development tools, and more.
(Added 2003-11-12, 1842 hits, more)
link thumbnail 4cheaters.de hot de translate
Large collection of hints and cheats for Acorn Archimedes, Amiga, Atari ST, C64, IBM PC, Sega Dreamcast, PC Engine, PlayStation, Game Boy, GBA, Super Famicom, Macintosh, NES, and others.
(Added 2007-01-09, 1982 hits, more)
link thumbnail 2A03.org
The NES music archive. Contains original music or cover versions, no game rips.
(Added 2006-08-26, 465 hits, more)
link thumbnail A/NES
NES emulator for AmigaOS written in 68k assembler and optimized for classic Amiga hardware.
What is this?
A/NES is a NES/Famicom 8-bit emulator for Classic Amigas. It was coded by Morgan Johansson (me) and Fredrik Schultz.
The emulator is entirely coded in 680x0 assembler and optimized for classic Amiga hardware.

Features
* Full 6502 emulatio ...
(Added 2006-11-28, 513 hits, more)
link thumbnail Acorn DarcNES Homepage
This is a port of the nice multi-system emulator DarcNES. It doesn't stretch itself too far and emulates just a handful of systems and it emulates most of the pretty darn well! The NES emulation is excellent and has sound!
(Added 2012-10-08, 416 hits, more)
link thumbnail Adventurers' Guild, The
The Ultimate Bard's Tale Resource. Covers the first three Bard's Tales, the Construction Set, the NES version, and more. Contains manuals, technical documentation, maps, downloads, songs in MP3 and MIDI format, emulators, and links. Also provides a mirror of the BardsTale.com website.
(Added 2003-11-12, 546 hits, more)
link thumbnail AmiEmulators Web
Amiga-hosted emulators of MSX, Game Boy, Master System, Game Gear, NES, and PC Engine programmed in assembler. Source code available.
(Added 2006-02-25, 742 hits, more)
link thumbnail Aphrodite
NES emulator for DOS.
Its very archaic, playing very few roms with minimal sound support.
[Entry points to emulator archive at Zophar's Domain.]
(Added 2006-11-17, 432 hits, more)
link thumbnail basicNES 2000
NES emulator for Windows written in Visual BASIC. Source code is available and has served as the basis for several other NES emulators.
[Files have been archived.]
(Added 2006-11-17, 643 hits, more)
1 2 3 4 5 6 7 8 9 10 11 >   Next Page >>
Search:

Tags

pokesmanualsrottshopsmsvaxacademicpointlessmoviesneo geoarnoldbugsqlcreatorslinuxpublishertriviaacornfpseonlineemulatorsromsvcsvisual basiccodedma designboulder dashdocsbard's talecapcommastertronicx86kim-1mike daillygradiuspspflyersgccbluemsxincompleteyoutubesupervisionquasi88excerptgpl6502fan gamesbox shotspasswordslynxbasicgame gearcharles macdonaldfaqsflashsolarissam coupĂ©snkibm pccasiophotos.netsg-1000scummmega drivegamasutramarcel de kogelrom listingswizgnuboysms plusschematicscatalogcomputerpandoraconverterspentagonsymbianinterviewsc16jrpgsencyclopediadownloadabandonwarecastawayarstechnicawikiremakengpctoolmulefrancekegsaction replayopen sourceradiohardwareculturedottcommodorehintszaurusmessarchivedscorpionresourcesasciiartxgsfmsxeliteharvestnintendographicsllamasoftpiratescps2id softwarecompressionitalyguidesmagnetic scrollsfdsarchiveshmupngcdlost sourcepcsxlisamagickitmtxconsolesatarikigbwinuaefaqmidifinal burnteotandycompatibilityoricmanualssemsunoscharactersspritesmaniac mansionapple 1pasopiaarticlej2meatari 8-bitvideosrichard bannistercheatspalmosiamuseumcartridgedemosegaunmaintainedpc-6000i18nvirtual boyralph baermac osdarcnesfirmwaremo6xzxtimelinepc-fxaquariusfpgaaltairtutorialjswddrgame designimagesfujitsu68kideforumchip8ultimax1scansbo zimmermanfeatureusenethexenfrenchatari800sonysaturnbooksftposf/1spaingermanhi-scoreswiilucasartsjavaguideaixmz-80delphishmupsdingoorpgsscott adamspcwadamgamesp20003dogizmondogbcnet yarozehucfpcecamputers lynxpv-1000copy protectiontaitocollectionfanzineps2homepageascii artpinoutsatari 7800rom hacksjeff minternecagidtvinterviewpdfpsiondavid foxartworkhead over heelssoftwarecomicscompilationsmastergearepsontrailblazercartridgescp/mcensorshipapple 2gsmagazinescomposerssgbgalleryc64freebsdgrim fandangomo5pc-88competitionsnatcherwscemulationlinksrzxti-89intellivisionluxorcspecsportdemo sceneanalysisunixsnes9xiosjapanesec128petcaanooukddjopenglunderdogshpintroductioncocohumorspace invadersgenesis plusrainbowastrocadexm6bookfamtasiapeoplereviewsandroidtutorialsspace questnvgatari stemp3quoteshandheldflashcartsstrategybeoscoversn64bioscolemwalkthroughsspectravideocollectingatari stgp32remakesreplicasbbc basicnetworkingneopopconverterpsxadsendingsndsarmcomputerstnkarchimedesrpgzx80amigahistoryms-dostoshiya takedagp2xpectrumdemosmusicpc98patchesuaenewslettermz-700gp2xrom hackx68000frontierassemblertoshibasmartphoneamstradsource codesega cdabc8032xmupenmipsmonkey islanddebuggerplayerssdksidgermanyfusefm-7jum52ngppluginfellowwonderswanneo4allmagazineelectronzx spectrumcopierscd-icolumnsinstallersmz-800sdlzorkgamebasesimcoupewalkthrough3d realmsclubmsxvbacreativisionmacvideocolecovisionjumpmanthalionapple 2duke nukemtranslationsseriesgifti-99/4amasterpodcastitmapsxm7squaresoftgamerick dangerousfrodomartin korthtcp/ipboycott advancemarat fayzullingremlinsmallgiana sistersjapancd32windows cefceatomcomputingmaking ofneopocottmac plusfinal fantasymega mannesterpom1basicnesremixescpugbamailing listdosboxstudio 2sovietbenj edwardstgemuinfonessonicjrpgonline playhugues johnsonsc-3000geocitiesdoomodyssey2konamiarcadetrs-80fan fictiondnainterpretersmaemomark3dragonti-92beebapogeeblogtosprogrammingvicedatabasez-codebabyhandyappletype-inoperating systemmediavgbron gilbertsinclairretrodevcalculatorsfcmultiface65816vic-20sierrahitchhikersf-7000thompowerpcsharewarepocketpcsharpconversionosxinfocomphilipsvectrexebayscigame boyversionsmodsbbcto8merchandiseindiana jonesmameinterpreterik+storynewsuae4alldumpingclonesenginecompilerscreenshotsadventure gamecivilizationwikipediasoundpsfbiographyedgedreamcastwinampos/2descentgithubqnxrisc oscommander keenunreleasednamcoarticlesiflibraryadventure gamesnsfarcadiaformatsfan artff7wolfenstein 3ddatasheetshereticpaul robsonsoundtracksjaguarauctionsto7rom hacking8-bitolafneszopharcommercialgamecubefm townsemulatorstreamingpreservationnewslettersfolklorezx81scummvmz80generatordiskmagsxboxtoolsustoolchaintvpc enginelittle johnpc-98technotescpcchronologydownloadssolutionsatari 5200ibmjupiter acereferencenesplus/4metal gearstellavideo gamesrecompilerwindows