magazine

1 2 3 >   Next Page >>
link thumbnail Acorn Electron Lives!
Dedicated to the Acorn Electron. Specs, expansions, hardware projects, game downloads, magazine covers.
(Added 2006-08-17, 854 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 696 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 647 hits, more)
link thumbnail Andy's ZX Spectrum Page
Magazine cover tape archive, Spectrum utilities for Amiga, documentation of Spectrum loading schemes, Your Sinclair Smash Tips booklets.
(Added 2006-08-11, 664 hits, more)
link thumbnail cbm264.com
Software and Information for your Commodore Plus/4 and 16. Downloads, GEOS, Scott Adams adventures, Tri Micro archive, C16 upgrades, magazine scans, systems and prototypes, Plus/4 service data.
(Added 2003-11-12, 544 hits, more)
link thumbnail Commodore Mania es translate
Commodore 64 page with games and applications archive, emulators, reviews, cover tapes, magazine scans, hardware mods.
(Added 2006-08-16, 852 hits, more)
link thumbnail Commodore Service Manuals
Service manuals for Commodore hardware in HTML format. Also Commodore magazine ads, schematics, and source code.
(Added 2003-11-12, 516 hits, more)
link thumbnail CPC Oxygen
Claims to be the number one online magazine for Amstrad computers. Also features an "Amstrad Action" magazine archive.
(Added 2006-02-24, 897 hits, more)
link thumbnail Digital A.N.A.L.O.G. Archive, The
scanned copies of Atari magazine A.N.A.L.O.G.
(Added 2003-11-13, 452 hits, more)
link thumbnail edicolac64 it translate
Italian Commodore 64 cassette magazine archive. Many Italian C64 games.
(Added 2007-01-10, 719 hits, more)
link thumbnail eZine X
Online magazine for Sinclair Spectrum fans.
(Added 2006-09-03, 461 hits, more)
link thumbnail FutureDisk
Claims to be the biggest MSX disk magazine still alive.
(Added 2006-09-28, 505 hits, more)
link thumbnail Happy Computer (German) de translate
Incomplete collection of German computer magazine "Happy Computer" at the Internet Archive.
(Added 2003-11-12, 981 hits, more)
link thumbnail Immortal C64
C64 emulators, game box scans, wallpapers, Commodore Format magazine cover scans, top ten.
(Added 2007-01-11, 437 hits, more)
link thumbnail Juiced.GS
Quarterly print magazine focusing on the Apple IIgs.
(Added 2007-10-10, 965 hits, more)
1 2 3 >   Next Page >>
Search:

Tags

mailing listdemo sceneonline playtutorialrottnecsdlvbabluemsxpokesreviewsxgsscorpioncheatsgermanycomputersscummtgemurpgspublisherdatasheetszx80cartridgecpuqlfirmwareatariportapogeecivilizationpluginblogemulationcompatibilityapple 2moviesmanualbiographyultimachip8xm7nsffrenchgp32emulatorhardwaresinclairinterpretersmark3mike daillyvaxclonesto7museumitalytriviapointlesspcsx3d realmscartridgessource codeflashcartsfuseunixebaymac plustvreplicasmastergearfaqsvideosi18nolafnesconverterscollectingarchimedesatari 8-bitgamebasestrategyrichard bannistergame gearmagazinesmessfceprogrammingcensorshipsoundremakejapanmediawiignuboyxzxremixesarmpv-1000solariscalculatorarstechnicamarcel de kogelmastertronicpetpiratespeopleneo geoodyssey2toshiya takedapc-98ascii artti-92fan artjupiter ace32xhandheldatari stellamasoftvic-20stellalost sourcenvgadamcompressionngcdsolutionsfpgacaanoomamearticlecommercialhitchhikerindiana jonesrom hackscommodorescreenshotsvirtual boysimcoupeandroidartworktechnotescmo5ngpc128jumpmanapple 2gsbard's talebeebfanzinewalkthroughsjapanesearchivednewslettersdottiosmega drivehandyspecskegsmaking ofpreservation68kgp2xpectrumgraphicsfan gameshexendebuggerwalkthroughwindowsgeneratorkigbfinal fantasynamcoshmupsdoombiosfellowfreebsdssemboycott advanceharvestopen sourceshmupnewscomputerdtvunmaintainedcompetitionfrodofan fictionvideogbamtxsciosxvicengpcralph baerpsffpsedma designmo6gizmondopasswordsdumping3docastawaymupenenginerom hackinginterpreterendingsti-99/4amarat fayzullinschematicsdocshintsthalionpatcheselectronyoutubespectravideostudio 2catalogpodcastftpwizkim-1compilationssmartphonejrpgsam coupĂ©darcnesaquariusarnoldcolumnsfrancegremlinpcwcpcuaeapple 1windows cecreatorsgamesgbpsxdingoohead over heelsmipspsionhomepagejswresourcesrom hackjeff mintercoversz-coderom listingsscanszx81ik+65816copiersappleifx86folklorecollectionmuledownloadpinoutsversionsj2mevideo gamessharpndslinuxstorypdfconversionatari 7800creativisioncompilercodegamecubewikipediaspace invadersinfonessfcdreamcastmp3bookdelphiatari stspritesincompletepentagonmz-800ron gilbertgame boypalmosexcerptcopy protectionpc-fxmz-80osf/1itplayersgeocitieshugues johnsonbbc basictutorialstrailblazerzorkpc-6000nesterchronologyanalysisscott adamssega cdamigasdkdiskmagsinterviewsneopocottflyersrisc osgp2xasciiartwinuaecultureflashc64ibmpom1converterpc-88imagesnet yarozemagazinezaurusgalleryonlinequasi88zophargenesis plusdemoarcadeluxorsnkpc98pc enginenintendosg-1000gamasutraddrintroductionsnatchertandyagipspuae4allsidremakesgradiusmetal gearthom6502toolaixwonderswanwikidragontype-inatomamstradbasicsymbianlucasartstnkguidesgplsegax1multifacesierramartin korthjum52camputers lynxfmsxstreamingquotesmsxrainbowoperating systemarchivefamtasiarpgedgespainpocketpcp2000downloadsbasicnesusenettaitocharles macdonaldarticlesaction replayinstallerslynxshopcasiotrs-80bugstcp/ipn64soundtracksfeaturebenj edwardsideusguidegermanlibraryneo4alladventure gamessaturnfm-7snes9xhuccps2toolsseriestimelinesharewareauctionsmaemosovietfpceoricfujitsu.netzx spectrumrick dangerousbbctosmz-700vgbtoolchainiapaul robsonaltairbox shotsdosboxgifmusicsms plusmapsmega manqnxphilipselitekonamiepsonclubti-89to8referencephotostoshibahistorycapcomcolemunderdogsboulder dashatari8008-bitacornassemblerneopopcolecovisionduke nukemgithubsonygiana sistersadsfinal burninterviewencyclopediasmsvisual basicgbccd32formatsforumdavid foxacademiccharactersnewsletterlittle johnhi-scorescommander keensc-3000romsz80atari 5200xboxunreleaseddescentfrontiercomicsintellivisionms-dosjaguarmac osbabyibm pcwolfenstein 3dpasopiaastrocadewscsf-7000beosplus/4midigamesnetworkinghpvcsmacfdsmagnetic scrollscp/msmallspace questx68000databasexm6nesabc80faqsquaresoftlisadnaps2hereticmanualsff7teoos/2translationsemulatorsgrim fandangorzxgame designlinksvectrexcomputingmagickitinfocomsonicukbooksscummvmmerchandisecocosunosretrodevc16ddjpandoraabandonwareconsolesdemosmastermodsarcadiabo zimmermanmonkey islandmaniac mansionpowerpcadventure gamesupervisionwinampradioopengljavacomposerssoftwarehumorrecompilergccjrpgscd-iid softwarefm towns