lost source

link thumbnail CottAGE
Multi-machine emulator implemented in Java, derived from MAME.
[Archived site navigation difficult; the download page can be found here. The binary has been archived, but the source code has not, and there do not seem to be any live mirrors of the latest version.]
(Added 2003-11-12, 529 hits, more)
link thumbnail LissNES
NES emulator for Windows written in Visual BASIC.
[Downloads have not been archived, and I have been unable to track down the source code. Binary at Zophar's Domain.]
(Added 2006-11-22, 469 hits, more)
Search:

Tags

mamewindowspasswordsfrancelittle johnsgbgizmondoarchimedesfcespace questintroductionrotteliteintellivisiongame designpasopiapc enginebard's talemagazinesrom hacksdumpingapple 1ibmmike daillypiratesto7astrocaderpgcamputers lynxreplicasbasicnescd32amigacomposersgbangpctgemubooksbeoshucpandoracd-ijswmanualremakesstrategyacornsharewarehardwaresf-7000mtxopenglpeoplemetal gearatari 5200casioos/2emulationinfonesjaguaragimesstcp/ipx86delphiadventure gamegifgamebasexm6toolspentagonultimahandyresourcesfm-7playersjapanesemanualsatomwikiscummvmsquaresoftfpsedoomtype-inascii artkim-1sidclonestriviaportdosboxclubadstoshiya takedazaurusmipsguidemz-80underdogssmallimageshintsarchivedinfocomoricmaking ofgame gearvic-20solarisnestertnkcoversformatscompilationsasciiartbenj edwardsjrpgflashboulder dashc64n64flashcartscp/mscreenshotsmulexboxrainbowcps2plus/4magazineconverterscomputersshmupnetworkingengineharvestid softwaresaturndatabaseaixsierranewslettersinterpreterfolkloreosxgplbo zimmermanbbchumorjupiter acemartin korththalioncollectinginterpretersgp2xpointlesslost sourceflyersfirmwaredemososf/1jumpmanpsfz-codespaintrailblazertaitorick dangerousmusicmupenblogatari 7800linksreviewsti-99/4aconsolesreferencerom listingsmerchandisecocomp3dreamcastcensorshippom1game boyxm7ushandheldmailing listgermanyjeff minterhead over heelsnsfgnuboyboycott advancefpgafpcepv-1000spritesstorydemo scenecompetitionifbiographycollectionssemrpgsarticleiacommercialbox shotsdotttoolcomputerxzx68krom hackingatari stgamemsxsega cdukemulatorsarchivewalkthroughspsionolafneshugues johnsonpetbasicmo5jrpgsfinal fantasyhexenwolfenstein 3demulator32xneo4allnewscompatibilitymarcel de kogelquotessmartphonecolem8-bitfeaturemaemounixmasterebayencyclopediastellaff7wizdebuggerlinuxtosdingoosms pluscartridgecastawaygamecuberisc osmastertronictvhi-scoresdocsdownloadsimcoupecreatorssdkdemoyoutubesg-1000adventure gamestimelinearnoldopen sourcefaqscomputingpokesbookc16arcadewindows cecreativisiondarcnesteocpcgeneratormediamega drivesinclairmodswinuaelisa.netibm pcsoundtracksremakez80catalogcmidionlinekigbsnes9xarcadiadavid foxincompletescott adamsitgccpcsxfrodospace invadersgeocitiespsparstechnicagamasutravectrexphilipsmz-700dtvsolutionsradiowonderswantoshibasnatcherconversionbluemsxcharles macdonaldsonicfm townsdnadescentfamtasiaspectravideofan gamesddrbbc basiccpumac ospinoutsralph baerrecompilerdma designitalypdfsymbiannet yarozenvgmoviesoperating systempluginunreleasedgiana sistersadamstudio 2fmsxaction replayscansneo geoscorpiongraphicssc-3000aquariusx68000usenetmarat fayzullinnintendoi18niosfreebsddiskmagssource codesupervisionsunosandroidatari 8-bitbugsfdsvideo gamespocketpcsoundmonkey islandnewslettervideosdownloadscodewinampsciphotosanalysistechnotesepsonhpchip8altairllamasoftcommodorecompressiontrs-80multifaceluxorps2faqx1abandonware65816fellowremixespc-98final burnonline playfan artscummlucasartsbiosgithubquasi88vgbneshitchhikergbcmastergearron gilbertrichard bannistermark3commander keenfrenchcopy protectionbeebcivilizationforumamstradkegsshopsdlacademicj2mefusetoolchaingremlinfujitsucolecovisionspecsmo6sharpgp32vcsodyssey2p2000to8babynecgrim fandangorom hackhereticassemblersegangpexcerptpc98wiizx81romsndsappleduke nukemvirtual boypaul robsonpodcastngcdmuseumlibraryti-92vbaik+mac plusuae4allprogrammingapple 2zopharfrontierzx spectrumuaecapcominterviewspcwqlshmupsgalleryjum52smshistorysonyqnxgp2xpectrumcheatsjapancomicscharacterspatchesschematicspalmoscaanoo6502cartridgesvisual basic3d realmsthomzorkddjauctionslynxsovietmz-800seriesmagnetic scrollsneopocottarmedgearticlesmapsrzxfanzinevideotutorialsartworkgamescopiersviceindiana jones3doc128atari steneopopendingszx80abc80homepagecompilerfan fictionxgsgradiussoftwaremagickitideapple 2gsti-89converterstreamingpublisherkonamiunmaintainedculturedatasheetscolumnstranslationsgenesis plusms-dossfcpowerpcpsxretrodevpc-88versionsftpsnkwsctandytutorialcalculatorpreservationmaniac mansionvaxinstallerssam coupĂ©walkthroughpc-6000pc-fxgermanatarijavawikipediamacmega mannamcodragonapogeechronologyguideselectronatari800interview