lost source

link thumbnail CottAGE
Multi-machine emulator implemented in Java, derived from MAME.
[Archived site navigation difficult; the download page can be found here. The binary has been archived, but the source code has not, and there do not seem to be any live mirrors of the latest version.]
(Added 2003-11-12, 577 hits, more)
link thumbnail LissNES
NES emulator for Windows written in Visual BASIC.
[Downloads have not been archived, and I have been unable to track down the source code. Binary at Zophar's Domain.]
(Added 2006-11-22, 507 hits, more)
Search:

Tags

pc-fxps2castawaywizfm townsnet yarozeconvertersnewslettersmsxsf-7000ibmralph baermark3mastergearcomposersrainbowitbenj edwardsfpgafaqssierragameszophargplretrodevllamasoftelitegraphicsflashapple 2cpunamcoos/2iosdocsmarat fayzullintoshibaarcadegizmondotechnoteshi-scoresboulder dashpc-60003d realmscomicscollectionpodcastduke nukemphilipsdemoencyclopediasolarisinterviewsmarcel de kogelgamasutrasam coupĂ©mupenbasichumorosxkigbromsemulatorscoversfellowcolecovisionfujitsungcdtrs-80geocitiesplus/4arcadianewsletterscott adamstandy3dondsddrfpseti-99/4adnamesssnkhexenamigacreativisionfreebsdscummgradiuswonderswanpeoplebookvbasnatcherboycott advancescreenshotstoolsmtxfm-7biosgallerydreamcastp2000rom hackingxm6cheats.netbeosyoutubeartworktoolthommz-80censorshiptoshiya takedaatarijumpmanpointlesspsptvjeff mintergp2xpectrumseriesid softwarezx spectrumlibraryhistoryamstradarticlesfeatureaction replaycomputervic-20online playaixtranslationsddjrzxrecompilerrick dangerousgamecubeti-92intellivisionportolafnesmulegameinterpretersfirmwaremo5debuggerpowerpcpocketpconlineintroductiongeneratormanualsrottmamecommander keencd-imuseumhucgp2xz80shmupspentagonrpgradioiftriviawscpetvicescanswinampepsonti-89trailblazerlisafrontiermanualcocoapplensfj2mepiratesvcsqnxbbc basicstreamingnvgpsionvaxhandyopen sourcepublisherpdfmaniac mansionbbccomputerssmallrom hackngppc98articlewikisolutionstcp/ippasopiafolkloresharewareprogrammingmastertronicneopopschematicssms plusresourcesneopocottoperating systemvirtual boycopy protectioncd32i18nidesimcoupejapanesecasiofan fictionstrategyoricastrocadelucasartsinstallersc128aquariusmo6referencekim-1magnetic scrollscapcomwindowsgiana sistersandroidpinoutsdingoox1remixescatalogacademicsoftwarechronologybookscollectingmagazinecharles macdonaldebayversionsedgecolemmagazinesik+storyjswcreatorsusenetdelphiatari sthugues johnsonstudio 2toolchaingame boynewszorkformatssupervisionxgscartridgemoviesexcerptneo geopsxx68000abandonwaressem68ksunossega cdsonichintsopenglcomputingquoteswiimediaarchiveddragonff7zx80snes9xgccdescentsmartphonequasi88unixrichard bannisterimageswinuaearnoldhereticbluemsxguidejapanpcsxculturefranceukarchimedesatomcamputers lynxjavaascii artpc enginejupiter aceagiadamdatabasepandoragithubgnuboyindiana jonesconversionfcesoundtracksdiskmagsadventure gamepluginvisual basicendingscharacterspcwconverterscorpionwikipediaabc80sg-1000apple 2gsforumspecscopiersreplicasfan gamesdatasheetsmz-800game gearsovietsoundpokes8-bitremakedosboxphotoscvideoszx81zaurusinterviewrpgsusc64odyssey2interpreterflyersspace questanalysismapsnesterwalkthrougharchivedumpinglinuxftpkegsn64wolfenstein 3diaincompleteuaeenginelinksuae4allapple 1unmaintainedinfocomatari 7800arstechnicaibm pcatari steharvestsaturnreviewsmonkey islandcalculatorasciiartbeebmultifacemz-700tnkgremlinteoshopmac oscartridgesz-codebugschip8spectravideotutorialngpctype-inassemblerunreleasedflashcartstosauctionsmidifuseremakesbabyms-doscommercialsource codelost sourcepv-1000final fantasyelectronatari 5200codedownloadscompilershmupbox shotswalkthroughsspritesnesgamebasefamtasiabiographysfcmp3demo sceneapogeec16compilationsnecjum52acornron gilbertarmclonesqlsgbhardwareto8neo4allrom listingsgifmasterbard's taleto7jrpgfmsxatari 8-bitsdkmega drivesmspreservationx86playerspom1faqcompetitioncaanoohpmagickitpatcheswindows cedoomsharpdavid foxfrodonintendogermanyrisc osultimatimelinexboxmaemolittle johnsonymaking ofmipsgp32emulationgermanhomepagecompressionosf/1fpceunderdogstaitotgemubasicnesmetal gearpaul robsonsidscummvmgame designtutorialslynxthalion6502symbianmac pluscp/mjrpgscompatibilityfanzineblogdarcneshead over heelsguidesdottvideo gamesvideospainluxoremulatorpasswordsaltairxm7squaresoftgbcdtvpalmosmacmartin korthsegakonamiscigenesis plusitalyconsolescolumnsstellacpcmerchandisegbacivilizationmailing listbo zimmermanjaguarmodsdemospc-98musicmega manatari800clubadventure games65816infoneshandheldspace invadersvgb32xgrim fandangofan artmike daillyfinal burnsinclaircommodorefdsxzxcps2psfrom hacksvectrexhitchhikerdownloadsdlfrenchpc-88networkingadssc-3000dma design