freebsd

link thumbnail iNES: Portable Nintendo Emulator
iNES is a program that emulates Nintendo Entertainment System (NES) and Famicom videogame consoles on your computer. It plays NES games on PCs, PocketPCs, Macs, Unix boxes, etc. The idea to write a NES emulator originated from Alex Krasivsky who found some Famicom programming information on the Net and wrote the initial code. At some point, Alex lost interest in the project, while I ev ...
(Added 2003-11-12, 413 hits, more)
link thumbnail MasterGear
Sega Master System (Mark III in Japan) and Game Gear, SG-1000, SC-3000, SF-7000, and Mark II emulator for FreeBSD/x86, Linux/x86, and Solaris/SPARC.
(Added 2003-11-12, 640 hits, more)
link thumbnail TuxNES
[A]n emulator for the 8-bit Nintendo Entertainment System. Currently, the emulator has been tested on Linux, FreeBSD, and NetBSD, all running on i386 processors.
[...]
TuxNES is based on Nestra, a great public-domain NES emulator by Quor.
(Added 2003-11-12, 285 hits, more)
link thumbnail Virtual GameBoy
Virtual GameBoy (VGB) is a program that emulates the Nintendo GameBoy handheld on your computer. It runs GameBoy, Super GameBoy, and GameBoy Color games on PCs, Macs, PocketPCs, Unix boxes, etc. VGB also helps debugging GameBoy software without using a costly development system.

Being fascinated with GameBoy as a cheap handheld computer, I started writing VGB in 1995, afte ...
(Added 2003-11-12, 437 hits, more)
link thumbnail Virtual GameBoy Advance
Virtual GameBoy Advance (VGBA) is a program that emulates Nintendo's GameBoy Advance on your computer. It runs GameBoy Advance games on PCs, PDAs, or just about any other sufficiently fast computer. It also helps debugging GameBoy Advance software without using a costly development system.
(Added 2003-11-12, 280 hits, more)
link thumbnail Yabause
Yabause is a Sega Saturn emulator under GNU GPL. It currently runs on FreeBSD, GNU/Linux, Mac OS X, Windows, Dreamcast, PSP and Wii.

Yabause support booting games using Saturn cds or iso files.
(Added 2006-09-20, 307 hits, more)
link thumbnail ZSNES
SNES emulator heavily optimized for x86.
[This emulator has bugs that may not matter much when playing games but can cause serious problems when it is used for development.]
(Added 2003-11-12, 404 hits, more)
Search:

Tags

pcsxcartridgesusluxorhugues johnsoncopy protectiontimelinegame designmipslinksspace questwindows cedemo scenemaemogamesconversionhead over heelsmupennetworkingarmps2cosf/1abc80schematicspodcastjum52acorninterviewssega cdmamefreebsdtoshiya takedafolklorepowerpcflashsquaresoftapplesupervisionemulatorsteopluginfaqralph baerbenj edwardsinfonesacademicmultifacebasicnesphilipsvbaportjaguarhitchhikerdownloadedgepc-6000.netbeosresourcesdtvsoviethandheldmaster65816nsfcapcomrisc ospandoraxgsconverterebaypaul robsonsymbianzx spectrumik+arcadearnoldinstallersadamdatabaseradiooperating systemiaatari steplayerstgemufrontiertoolchainneo4allmo6atari800astrocadeuae4allfpceosxsgbukpointlessartworkapple 2c64videomark3magazinesfm-7passwordsmtxngpcsolutionsngcdunderdogscatalogjeff minterbabyneopocottmacstrategyunreleasedgermanyasciiartjrpgssdlmerchandisemessspaindemosbbctaitoapple 1thalionfinal burndemosoundtracksolafnessmsdma designwscpasopiamastertroniconlinevaxcocogermanmetal gearaixpc enginecensorshipindiana jonesmodsgamecubekigbrzxnewsletterxm6x68000solarisgame boyadventure gamesp2000qnxuaegradiusftpvic-20ngpatariwiiduke nukembiosid softwaredelphicaanootrailblazerstellahexentriviainterviewz-codeshmupcartridgereplicasibmfan artlisainterpreterssam coupĂ©idelinuxsaturnforumgbavirtual boyfpsebugsmaniac mansionfujitsucomputingaltairspecsdownloadsscreenshotspentagonddrx1storycollectinginterpreterclubsmallpocketpccompressionseries8-bittandycp/mndsstudio 2handypc-fxpiratesremixescastawayroms3dosharpthomhi-scorestechnotesscummvmcheatsdarcneszorkhintsjavahppcwjupiter aceagifrodojumpmancompatibilitytosguidecamputers lynxdingoowindowsto8gccatari 7800martin korthcomputerqlarticlemusictcp/ipmagickitcommodorecomposerschronologynewswizcolumnspsxgifanalysisandroidcommercialcps2mailing listsonicn64infocomencyclopediamp3unixmapsvectrexsoftwaregizmondoshmupspom1rick dangerouscasiobookcivilizationmonkey islandgraphicsvicednasnklucasartsnamcointroductioncalculatorculturepatchestvpokessdkfeatureneo geoodyssey2creativisionauctionsapple 2gstnkmz-700archimedesdiskmagsprogrammingfellowzx81smartphonefanzinegamebaseunmaintainedwalkthroughsdebuggermac plusdocsgplbeebjrpgitalynecvideosnintendodatasheetssidwonderswandottapogeexboxfmsxsonydumpingwalkthroughrotttoshibagp32francezx80arcadiaamstradgallerybox shotscoversemulationmarat fayzullinnet yarozecodesharewarecolemcd-igbchumortype-inkim-132xmike daillyzaurussnes9xpc-88hereticretrodevfcenvgpv-100068kflashcartssc-3000abandonwarelynxmsxnewsletterswikipediamanualssoundjswfamtasiafusetoolsenginefan gamesgame gearscummpspemulatorspectravideoddjtooltutorialskegsspriteswinampreviewskonamisinclairifrecompilerscims-doscomicscharactersfm townszopharflyersamigabbc basiclost sourceatommoviesquasi88compilerassemblercomputersoricpreservationpdfcolecovisionhistorygnuboybo zimmermanto7plus/4magnetic scrollsvcsvideo gamesimageshucdescentfaqsgremlinelitesms plusbluemsxhomepagerom hacksultimascorpionconvertersatari 5200arstechnicasimcoupereferenceitmo5vgbascii artpsionharvestscott adamspinoutschip8hardwareintellivisioniosfpgacpugithubibm pcbiographycharles macdonaldmega drivemagazinespace invadersc16fan fictionaquariusrichard bannisteratari stonline playjapanesemaking ofron gilbertendingsgiana sisterscopiersrom hackingadventure gametrs-80xzxneopopmarcel de kogelboulder dashvisual basicmega mansf-7000nesfinal fantasyfdssierragamesnatcherepsonboycott advancez80sfcconsolesrom hackremakeversionsx86manualelectronssemjapanmac osphotosstreamingformatspsfdreamcastcompetitionpetpeoplecollectiongp2xarticlesblogarchivedrainbowguidessource codecreatorsfirmwarepc98bard's talesunosexcerptrom listingspublishercloneswolfenstein 3dc128basicrpgbooksmidii18ntranslationspalmoscommander keengeocitiesti-99/4ageneratorquotesdragonmuseumtutorialgenesis plusgamasutragp2xpectrumnesterarchivedavid foxos/2grim fandangodoomsegaopenglrpgscompilationsyoutubeti-89adsxm7action replaywinuaewikimz-800little johnusenetsg-1000librarypc-98french3d realmsff7cpcmediascansshopj2me6502remakesmastergearatari 8-bitopen sourceincompleteti-92cd32mz-80muledosboxllamasoft