freebsd

link thumbnail iNES: Portable Nintendo Emulator
iNES is a program that emulates Nintendo Entertainment System (NES) and Famicom videogame consoles on your computer. It plays NES games on PCs, PocketPCs, Macs, Unix boxes, etc. The idea to write a NES emulator originated from Alex Krasivsky who found some Famicom programming information on the Net and wrote the initial code. At some point, Alex lost interest in the project, while I ev ...
(Added 2003-11-12, 550 hits, more)
link thumbnail MasterGear
Sega Master System (Mark III in Japan) and Game Gear, SG-1000, SC-3000, SF-7000, and Mark II emulator for FreeBSD/x86, Linux/x86, and Solaris/SPARC.
(Added 2003-11-12, 772 hits, more)
link thumbnail TuxNES
[A]n emulator for the 8-bit Nintendo Entertainment System. Currently, the emulator has been tested on Linux, FreeBSD, and NetBSD, all running on i386 processors.
[...]
TuxNES is based on Nestra, a great public-domain NES emulator by Quor.
(Added 2003-11-12, 387 hits, more)
link thumbnail Virtual GameBoy
Virtual GameBoy (VGB) is a program that emulates the Nintendo GameBoy handheld on your computer. It runs GameBoy, Super GameBoy, and GameBoy Color games on PCs, Macs, PocketPCs, Unix boxes, etc. VGB also helps debugging GameBoy software without using a costly development system.

Being fascinated with GameBoy as a cheap handheld computer, I started writing VGB in 1995, afte ...
(Added 2003-11-12, 575 hits, more)
link thumbnail Virtual GameBoy Advance
Virtual GameBoy Advance (VGBA) is a program that emulates Nintendo's GameBoy Advance on your computer. It runs GameBoy Advance games on PCs, PDAs, or just about any other sufficiently fast computer. It also helps debugging GameBoy Advance software without using a costly development system.
(Added 2003-11-12, 387 hits, more)
link thumbnail Yabause
Yabause is a Sega Saturn emulator under GNU GPL. It currently runs on FreeBSD, GNU/Linux, Mac OS X, Windows, Dreamcast, PSP and Wii.

Yabause support booting games using Saturn cds or iso files.
(Added 2006-09-20, 415 hits, more)
link thumbnail ZSNES
SNES emulator heavily optimized for x86.
[This emulator has bugs that may not matter much when playing games but can cause serious problems when it is used for development.]
(Added 2003-11-12, 512 hits, more)
Search:

Tags

dotthistorystoryguidegithubmtxxm7pentagonpointlessnewsmartin korthbookiacomicscharactersplayersjupiter aceconvertersuae4allbooksversionsarticledescentsmallflyersagigermanypsionsource coderisc osmulerpgapple 2academicvectrexmega drivexm6creatorsj2mecomposerspc-fxgizmondolibraryincompletefusepalmosc128censorshipaltairdocslost sourcefan fictiondiskmagsemulatorsjapangamescott adamsfinal burndarcneswalkthroughssam coupĂ©vgbfcearnoldcaanooddronlinegamesdelphiti-99/4atriviagremlinpetftpsnkssempandoracps2duke nukemjeff mintergame boyhugues johnsonsierramz-700zorkinterpretergenesis pluscommodoremetal gearspritesmagnetic scrollsmanualrom listingsvideofamtasiahomepageunixlittle johnassemblerdumpingacornsymbianarmwinampmarcel de kogelwonderswanusenetosf/1hpnewslettersnvgdemo scenescihintsapplearcadeadventure gamesradio32xneo geooricmidispectravideonintendocivilizationdoomcolematari stmo5jaguarsegauaetaitohi-scoresndscd-ifmsxmastertronicpasswordsfujitsuatari 8-bitbox shotsvideosreferencedma designcollectioninterviewshmupindiana jonespeoplekonamicommercialnet yarozeresourceswindows cetutorialsmike daillysupervisionscummcatalogralph baerrom hackingartworkatari 5200mastertvtnkpasopiallamasoftcommander keendreamcastclubultimajavarainbowsms pluspaul robsonwalkthroughunreleasedreviewsmo6kim-1computersmacpc-6000final fantasysgbatari800interviewsfellowdownloadsenginegeocitiesneopocottnetworkingtoolnecarchimedesmessscreenshotsluxorpirates68kpreservationmaemocolecovisionsimcoupesdkx68000frontiernesterretrodevstrategycoversmz-800scummvmz-coderon gilbertrick dangerousarchivescorpionfeaturepublishertrailblazertoolsbiographyauctionshandyshmupsteotosphilipssf-7000flashcartsmagickitdebuggerbard's talezx spectrumgermanquasi88wolfenstein 3dspace questdatasheetsjumpmangraphicspc98handheldsonywindowsrecompilerp2000gamebasesfclucasartsabc80sonicsmsmastergearcp/msinclairfm-7romsmagazinekigbpcsxngpccreativisionapple 2gsddjboycott advancemovieszx80cqlmerchandiseatariflashsidmega manto8electronpv-1000excerptfrenchrzxmamedemodnazx81ik+faqsfolkloregradiussolarissnatcheradsunmaintainedfpgaarstechnica.netsaturn8-bitcompetitionc16intellivisionfanzinevcsguidesjapaneseformatsmonkey islandencyclopediaaixjum52vicetcp/ippdfukos/2squaresoftfirmwarensfxboxatari stebbc basicremakemsxpatchesfm townsdatabasex1astrocadeforumboulder dashcompilationscalculatorcastawayqnxarchivedsnes9xhitchhikern646502convertermapstgemujswchip8computerhexenendingsff7action replayelitesoundtrackshumorrichard bannistermagazinesvisual basichereticintroductiondosboxxgsfpcethomsunosebayfrodorom hackanalysismodsmusicculturewscgrim fandangomark3casiospace invaderszaurusstellagp32bioscompressionseriesdavid foxmailing listtimelineitalymz-80articleswikiunderdogs3dowinuaesc-3000installerscocogame gearascii artneopopatomtutorialgnuboydemoscd32infocomto7itshopschematicsreplicasasciiartconversionsoftwaresharpiffdsbugsosxibmx86gcccheatsscansinfonessolutionsbasicnesstudio 2francenewslettermp3programmingdragondownloadmultifacetoshibavic-20basictechnotesngcdgame designvbapsxps2c64ti-89benj edwardsvirtual boyjrpgsrom hacksfreebsdmarat fayzullinremixes65816olafnesandroidadamgamecubez80pom1ioschronologysharewarengppsffan gamescartridgesdlcopiersspecsmupenms-doscodeportlynxtranslationscpucamputers lynxpowerpcxzxamigaabandonwarestreamingdingoobo zimmerman3d realmsgp2xepsonwiicpcinterpreterscopy protectionclonespc-88idegallerynamcogamasutrati-92pcwadventure gamepc-98sega cdid softwarezopharbeosibm pcmuseumgifi18nspaintype-inarcadiaremakesapple 1neo4allfpsepc engineedgequotesodyssey2head over heelsbabymaniac mansionlinksrpgskegsgiana sisterscompilergbablogsoundconsoleswikipediagplaquariusmac plusnesmipsamstradusrottemulationsmartphonejrpgbbcgeneratormac oslinuxapogeelisaemulatorbluemsxcolumnsmediaatari 7800thalionyoutubemaking ofopengltoolchaintoshiya takedacharles macdonaldmanualsgp2xpectrumpocketpcphotoswizcompatibilitypodcastgbcsg-1000vaxsovietpokesopen sourcecomputinghardwareoperating systemharvestdtvonline playpluginfaqplus/4pspfan artimagestrs-80collectingvideo gamestandyhuccartridgesbeebcapcompinouts