flyers

link thumbnail Arcade Flyer Archive, The
Source for classic arcade video game promotional flyers.
(Added 2003-11-12, 706 hits, more)
link thumbnail gamengai enja
Database of Japanese video games with capsule reviews, plus many flyers and omake.
(Added 2007-01-05, 439 hits, more)
link thumbnail SEGA-Network.de de translate
Das Informationsportal rund um SEGA Konsolen und Spiele
Hier erhaltet Ihr alle Informationen zur Geschichte der SEGA-Konsolen und Arcade-Boards, ihrer Technik, den Versionen, allen erhältlichen Spielen mit Cover, Screenshots, Daten, Cabinet-Pics, Flyer, Videos, Bewertung und Reviews, sowie massig Downloads von Spieledemos, Werbevideos und -anzeigen, MIDIs, Wallpaper, Game Co ...
(Added 2012-10-08, 539 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 307 hits, more)
Search:

Tags

beebsdklibraryatari ststreamingstudio 2ascii artngpcd32collectiondumpingmailing listjaguarremixessource codemaemoatari 8-bitintroductionmac pluschip8tcp/ipkim-1cpcatari stedatabaseonline playarchimedesflashcartssharewareclubbbc basicmagazinescamputers lynxrainbowmusiczx spectrumspritessierrarom hacksversionscjumpmanhi-scoresmsxneopocottc64moviessam coupéatari 7800creatorsgamecubebeosddjschematicsfaqsxzxcpugp2xpectrummz-80aixtriviafellowmz-700fanzinecopiersreferencedosboxlucasartsbiographyduke nukemmo5babyedgecreativisionjrpgibmmike daillypc-98bard's talemachucneopopmapsgccpaul robsongamesdelphielectron3dohandheldscorpionwinampmanualpokessoftwareandroidresourcessunosnamcoconsolesmediageocitiesapple 2gsodyssey2mz-800operating systemmp3arstechnicakigbcomputerlynxremakep2000newsconversionvbawizconvertercheatstaitofpcetrs-80mamespainsgbbugshereticcartridgefan artsdlcasiodoom3d realmsdatasheetsdiskmagsquasi88apple 1scummzorksmartphoneaquariusgbathalionspace questrpgremakesjeff mintergremlindownloadcomposerscompilationsfcesmalllinksspectravideographicsmipssoundflashfdsagiforumsf-7000nvgmagickitbluemsxzx81hexenpodcasttype-inssemvideopasopiaspace invaderswiiabandonwaretranslationsmasteratari 5200ralph baerxm6youtubeadscensorshippdfbasicgenesis pluspsfreviewssinclairmetal gearsquaresoftz80c128toshiya takedasc-3000pointlessneo geoanalysisik+final burngrim fandangoreplicasportjum52nesfirmwarecoversonlineifimagesmartin korthpc engineradiocatalogcomicsxgsnewsletterepsonsaturnpom1articleshandycartridgesfpsellamasoftmega mandingooatariosxgame designti-99/4aromsarticlesymbianpentagonj2mefolkloreapogeesg-1000gbcnetworkingemulatoraltairpspdemo scenex86photosdottmo6tgemukegsseriescd-idavid foxarcadechronologycomputingpeoplerpgsmagnetic scrollsgamebaseunmaintainedplayersitff7faqcalculatorsoundtracksdownloadspc-6000sonicdnaapple 2merchandiseunderdogsrecompilerinfonesmaniac mansionrisc osamigascansos/2richard bannisteritalycapcomtechnotesfmsxfusebasicnesc16gp32adventure gameunreleasedpowerpcvicetimelinecps2pocketpcblogfamtasiafujitsumark3computerscompatibilityfrenchuaecolumnsguidesonyharvestconvertersinfocomdebuggerwalkthroughscompetitionaction replaypatchesstelladdrsnatchergamasutramulewindows cevic-20artworkassemblerarchivesmscococharactersprogramminggallerysega cdeliteuae4allibm pcscott adamsacademicfm-7gp2xwindowstoolspreservationfm townsdemosfranceshopquotesfan fictionndsmidiwinuaeencyclopediaacornms-dospcsxgizmondoscummvmfrontiersolutionsmonkey islandwonderswannecemulationhpgermanypsxtoshibabbcmupento8head over heelsdemodescentx68000intellivisionx1interpretersgame boyxboxmuseumstrategyfan gamesflyersspecsretrodevvideosgermanqltutorialtrailblazerrom listingsmanualstutorialspasswordsneo4alllisadragonmess32xcodeenginewikidma designfeaturehistorymultifacecharles macdonaldto7ps2ngpcarnoldpc-88plus/4shmupsrom hackinghumor6502gradiusultimacompilerdtvcastawayukindiana jonesstorybenj edwardslittle johnsnes9xplugindreamcastgeneratorsidatomsfcjapanmac osbooksolafnesvcsappletooldocshugues johnsonvectrextandyendingsfinal fantasynintendovirtual boyron gilbertunixpv-1000mega drivecopy protectiongiana sisterssnkzaurusadamwsczx80iarzxtoolchainpetwalkthroughscifrodofreebsdnsfatari800tnkusenetzopharti-89emulatorspc-fxsimcoupemarcel de kogelid softwareformatslinuxpiratesftppc98vaxjrpgspublisherpinoutsauctionsorictvopen sourcegithubkonamisharpcommercialclonessovietebayincompletegpli18nmarat fayzullincaanooinstallersgame gearthomn64screenshotscultureopenglnesterpcwidearcadiaosf/1guidesinterviews8-bitjswteo.netrick dangerousboulder dashgamecommodorepandoraasciiartfpgahardwareastrocadeuswolfenstein 3dbo zimmermancolecovisionadventure gamesbiospalmosvgbabc80newslettersboycott advancehomepagenet yarozejapanesemtxiosmaking ofinterviewcp/mcompressionmagazine68kqnxdarcnescommander keenarchivedsegasupervisionpsionsms plusjavabox shotsvideo gamesgnuboy65816luxorarminterpreterhintsmastergearwikipediashmupz-codeti-92visual basichitchhikerxm7lost sourcemastertronicrottgifamstradbookngcdphilipscollectingtosrom hackcolemsolariscivilizationmodsjupiter aceexcerpt