flyers

link thumbnail Arcade Flyer Archive, The
Source for classic arcade video game promotional flyers.
(Added 2003-11-12, 696 hits, more)
link thumbnail gamengai enja
Database of Japanese video games with capsule reviews, plus many flyers and omake.
(Added 2007-01-05, 435 hits, more)
link thumbnail SEGA-Network.de de translate
Das Informationsportal rund um SEGA Konsolen und Spiele
Hier erhaltet Ihr alle Informationen zur Geschichte der SEGA-Konsolen und Arcade-Boards, ihrer Technik, den Versionen, allen erhältlichen Spielen mit Cover, Screenshots, Daten, Cabinet-Pics, Flyer, Videos, Bewertung und Reviews, sowie massig Downloads von Spieledemos, Werbevideos und -anzeigen, MIDIs, Wallpaper, Game Co ...
(Added 2012-10-08, 526 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 305 hits, more)
Search:

Tags

plus/4sdkcalculatoryoutubecheatsvaxmaniac mansionadsprogrammingfreebsdgeneratorpc enginetnknintendounreleasedzopharrom hackinterviewemulatorwolfenstein 3datari800cpcuae4allnesgame designhi-scoressinclair.netllamasoftnamcofm-7quasi88stelladatabasescummvmfeatureapple 1reviewslittle johnvicemagazinesneopocottrom hacksspaingiana sistersnvgms-doskim-1pc98iosjapanesecto7emulationplayersincompletescreenshotssmartphonevirtual boygp2xcamputers lynxindiana jonescatalogspace invadersphilipsarcadexm7germanymerchandisesf-7000shmupsadventure gamesscorpiongpldatasheetsrick dangerouslucasartscp/mdumpingdarcnesidedownloadsgremlinatari 8-bitschematicsmuletgemuti-92hitchhikerxm6versionsauctionscomicspluginfinal fantasyatari 5200uscartridgesnewsletterrom hackingcultureatari stecommodorerpgsbabyjrpgsflashcartsagioperating systemconverters3dogccmuseumrichard bannistersg-1000midipublishermoviesgeocitiesron gilbertid softwareanalysisfirmwaremasterformatscodevideoradioibm pcopenglrom listingsteopcsxmagickitseriessource codesfcspritessc-3000c16mtxatari stfrontiernewsatominterpreterfanzinewindowsstorypowerpcpsparchimedesmac plusbard's talearstechnicacd-iunmaintainedarchiveditinfocomhpgbaxzxenginetoolssonicflashmega driveifhandygame boypc-98marat fayzullincolumnsjupiter acefan fictionsms plusnet yarozeacornjapangbctoolconversionodyssey2fceepsonultimamastergearvisual basicngparticletutorialsharewareosf/1basicnesdtvonlineabandonwarehexencd32clubintroductiondingoosidvbagrim fandangothomchip8duke nukemconsolespsxdescentsunosjrpggp32vic-20ik+david foxbasicemulatorsrisc ospocketpcapple 2referencebbcngpctimelineaixhucmediaretrodevwinampcps2mike daillywinuaecomputingartworkdebuggerpeoplegametutorialscollectionfan gamessovietsam coupépetspectravideonsfmo6ps2githubtvmastertronic68kcivilizationcensorshiptrs-80demosamiganeopopinterpretersjswgraphicsclonesdosboxzx81rainbowunderdogshistorygnuboycomputerssciapplecolemx86mz-800fpsepaul robsonitalyjaguarvectrextandymark3dragonff7blogtype-inacademicadventure gameti-89pokescharacterswonderswanjum52technotesbeosbbc basicastrocademaking ofqnxarchiveti-99/4axgsdoomdelphic128studio 2bugscomposers8-bitpasswordskigbgamessdlsoftwarecompetitionlisaneo4allcoversc64squaresoftzx80toshibabiographymega mangizmondocharles macdonaldfolklorehomepagecolecovisionpreservationmagnetic scrollscompilationsaquariusmailing listguidesmodswiigp2xpectrumimagesguidequotesascii artmesscompressionzx spectrumsoundamstradtosmapscomputerfrenchtranslationspasopia65816specsftp32xpc-6000maemoflyersgamebaseopen sourceosxdownloadlost sourcei18nmz-80famtasiafpgamsxnetworkingos/2atari 7800handheldromssgbsharpngcdedgebenj edwardsmo5dma designfaqdottfan artchronologykegsmartin korthbioscommander keenthalionbooksusenetneo geomacportto8libraryz80installerswizmagazineibmpdfcompatibilityadamresourcesmipsgermanfujitsuralph baerjumpmanmameendingshugues johnsonlynxmanualcartridgecommercialukwalkthroughspsionelitecreativisionpv-1000solutionsfrancemetal geartriviaandroidshopharvestpiratesfmsxp2000abc80video gamesgame gearwikipointlessboulder dashddrwalkthroughunixremakeapogeerecompilertaitomz-700ssemscott adamsarticlesmultifacenesteratarialtairvcsfinal burnsupervisionbookoricbeebremixesdnacaanoopc-88snkj2mesmscasiopodcasttcp/ipndsphotosmarcel de kogelexcerpt6502hereticpalmossnes9xmonkey islandhumorpom1rzxmac osiainterviewscompilerstrategyfaqswikipediaz-codehardwaresmallreplicasencyclopedianewsletterssaturnvgbsimcoupehead over heelswindows cepcwlinksdemoasciiartqlfpcepsfsega cdluxorddjolafnesx68000galleryscanswscboycott advanceshmupmupenbox shotssegazaurussoundtrackssnatcherinfonesnecforumtoolchaincreatorstrailblazermp3javaarmrottsymbianspace questelectronxboxarcadiafrodopandorafm townsbo zimmermanvideosdemo scenetoshiya takedapatchesremakesfdsdiskmagscastaway3d realmsonline playcopiersgifmusicscummpentagoncpuuaex1dreamcastfellowpc-fxarnoldjeff mintergamecuberpgn64sierraconverterdocsassemblerbluemsxmanualssonyaction replaystreamingpinoutsgenesis pluszorklinuxkonamihintsapple 2gscocofusegamasutragradiuscollectingcopy protectioncapcomintellivisionebaysolaris