flyers

link thumbnail Arcade Flyer Archive, The
Source for classic arcade video game promotional flyers.
(Added 2003-11-12, 981 hits, more)
link thumbnail gamengai enja
Database of Japanese video games with capsule reviews, plus many flyers and omake.
(Added 2007-01-05, 578 hits, more)
link thumbnail SEGA-Network.de de translate
Das Informationsportal rund um SEGA Konsolen und Spiele
Hier erhaltet Ihr alle Informationen zur Geschichte der SEGA-Konsolen und Arcade-Boards, ihrer Technik, den Versionen, allen erhältlichen Spielen mit Cover, Screenshots, Daten, Cabinet-Pics, Flyer, Videos, Bewertung und Reviews, sowie massig Downloads von Spieledemos, Werbevideos und -anzeigen, MIDIs, Wallpaper, Game Co ...
(Added 2012-10-08, 821 hits, more)
link thumbnail Space Invaders Shrine, The Ultimate
The Classic Arcade Games Shrine. History, flyers, manuals, hints, clones, and more.
[This entry links to the Wayback Machine; the site currently hosted at this domain is bullshit.]
(Added 2003-11-12, 475 hits, more)
Search:

Tags

tnk3dosolarisvirtual boyfrenchgallerypandoradavid foxflashcartspetsaturndemossidfan fictionquasi88cp/mbeosti-89unixhintssdkformatspasopiangppowerpcnewsatari stewiiqladventure gamesgenesis plusmac osdreamcasttimelinemagnetic scrollstoolti-99/4aspainsierrasam coupémupenonline playpsfgp32pcsxps2homepagelisacompilationssf-7000epsonukunmaintainedfellowphilipsmanualsbasicthomatommagazineiosinfocomencyclopediapointlessfpseifrpgsneopocottgamasutrasonyssemolafnescivilizationpreservationi18napple 2taitomartin korthendingsshmupmanualz-codevideo gamesdragontutorialmastergeardatabase68kdebuggernvgcompatibilitysciconvertersmerchandiseretrodevnetworkinggithubgifbiosastrocadewikipediawindows cetoolchaincamputers lynxreviewsadventure gameopen sourcepc-6000coverssg-1000ndsmega drivesega cdfm townsblogcollectionhexengnuboydemo scenepokescapcomff7pspmz-800edgehandymacrzxplayerssmsdocsatariidehi-scoresrichard bannisteraixopenglhugues johnsonitalybookrecompilerc64apogeemarat fayzullinsovietromsenginemo5historyjupiter acefpcemultifacesharpmz-80trailblazersquaresoftvideostvatari 8-bitinterviewlibrarywindowsdatasheets6502jaguaramigarottllamasoftsmall.netcomputermo6vcsarchimedesindiana jonestoshibagremlinmuseummidifinal burnboulder dashcheatspatchesfamtasiaflyersmark3hpgame gearconsolespasswordspv-1000rom hackingrick dangerousbiographythaliondma designfanzineconversionhead over heelssms plusversionskonamizx8132xdoomsegageneratorarticlemagazinesultimarpgaquariussimcoupeosxsdldownloadsiausfrontierjavadumpingbugsitsharewarecpunintendoxboxvectrexzorkddrfdsfusesunostechnotesxm7vbapalmoscomputingsnkpom1guidesfaqmodspaul robsonemulatorsacademicauctionsinstallerscomicsadszopharnsfcomposersnewslettergame boycommodorexgsc128compressionmac pluspentagonadamx1excerptpodcastmipsto7jrpgqnxcompetitionosf/1sonicwizneo geotcp/ipdottdownloadx86studio 2porttriviaremixesjum52soundms-dosbox shotscalculatorascii artlinuxmsxsinclairzauruspsionnamcobard's talefinal fantasyapplexm6gamesid softwareusenetcartridgescastawayvgbgraphicsto8colemmapslost sourceunderdogsbooksbo zimmermannecclinksgradiuschip8bluemsxgamecubecharactersgrim fandangoj2megbasource codeodyssey2dingoogizmondogp2xpectrumharvestbenj edwardsnesmailing listreferenceasciiartonlinen64pc-98videoradiospecsagidosboxtype-indarcnesunreleasedibmfmsxmega mandelphioriccopy protectionpsxatari800creativisionsfcapple 1kigbacorndiskmagsflashmulebabycomputersremakesabandonwarepluginsnatcherdemomessgiana sisterspocketpchitchhikerarchivedfeaturefm-7programming65816ddjmaking ofreplicasamstradmagickitfaqscensorshipdtvartworkdnaquoteshandheldspace questaltairschematicscompilerstellapublishergbccodep2000fpgaelectronpc98nesterneo4allhuchardwaregermanyremakegamebaselittle johnscanstgemuarnoldgp2xdescentcatalogarmngcdaction replayandroidftplynxphotossupervisionmediamusicmarcel de kogelsc-3000arstechnicametal gearcps2folkloresymbianwinamptutorialskim-1solutionswscmoviespc-88cartridgesmartphonefcepinouts8-bitguidepeoplemz-700cocohumorintroductionwonderswanincompletecolumnsvicemasteremulationsoundtracksxzxscott adamsbasicneswikiarticlesrom listingsstreamingoperating systemscreenshotscd-ipdfvic-20freebsdyoutubetranslationsarcadiaanalysisngpctandygplinterviewszx spectruminterpreterwalkthroughsneopopfranceabc80scummarchivescummvmscorpionvaxpc-fxmamerainbowron gilbertc16apple 2gscasiowalkthroughmaemointellivisionshopcpccaanoosoftwareseriesmastertronicmtxcolecovisionemulatorresourcesbeebboycott advancejeff mintercommander keeneliteshmupsvisual basicmike daillypiratesjswmonkey islandarcadeculturespectravideox68000ti-92copiersfirmwaregermancreatorsz803d realmsspritesrisc ostrs-80sgbjrpgsimagesluxorlucasartssnes9xtoshiya takedaik+chronologyibm pccommercialforumtoszx80rom hacksuaegeocitiesgamehereticclubinfonesmaniac mansionfan artplus/4storyspace invaderscd32interpretersjapaneseatari 7800ralph baerpcwkegsfujitsuuae4allnet yarozefan gamescharles macdonaldjumpmanwinuaecollectingbbcduke nukematari stnewslettersassemblertoolsteogame designjapanstrategyrom hackgccatari 5200bbc basicmp3ebayconverterwolfenstein 3dfrodoos/2clonespc engine