fce

link thumbnail FCE cool enja
Incomplete open-source NES emulator for DOS that served as the basis for many other NES emulators.
Why I make NES emulator where many many emulator are available? I want to port NES emulator to PlayStation,but I can't find Portable C source except xNes,it is too slow for PS on R3000/33Mhz. so now I'm making NES emu for DOS/VGA first. My last target is PlayStation with portable code, s ...
(Added 2006-11-21, 499 hits, more)
link thumbnail FCEUX cool
FCEUX is a Nintendo Entertainment System (NES), Famicom, and Famicom Disk System (FDS) emulator. It supports both PAL (European) and NTSC (USA/JPN) modes. It supports both Windows and SDL versions for cross compatibility.

The FCEUX concept is that of an "all in one" emulator that offers accurate emulation and the best options for both casual play and a variety of more adva ...
(Added 2003-11-12, 980 hits, more)
link thumbnail FCEUXD SP
Fork of NES emulator FCE Ultra for Windows with extended debugging features.
(Added 2006-11-21, 516 hits, more)
link thumbnail NextFCE enja
Unmaintained port of open-source NES emulator FCE for FreeBSD/x86 and DOS. No source code available.
[English-language page is no longer live, but available at the Internet Archive.]
(Added 2006-11-24, 380 hits, more)
link thumbnail PlasticNES
Version of NextFCE for DOS with some bugs fixed.
[Entry points to the emulator archive at Zophar's Domain.]
(Added 2006-11-24, 351 hits, more)
Search:

Tags

metal gearsciinterviewarnolddumpinglinuxmoviespentagonamigaformatsinstallerscd-iremixesschematics.netvideo gamesbeebneopocottonlinefrancevideosgp2xpectrummessjaguargrim fandangosdlcd32fan artcopy protectionasciiartyoutubepandoraosxzx80gradiusdatasheetsdtvsoundpublisheridefpsenecpv-1000ultimagraphicsbox shotsmuseumsimcoupefinal burntranslationswinampspace invaderscastawayseriesgamasutrasfccapcomrom listingsneopoppsfspriteslost sourcepokesconsolesjavainterviewsxgscopiersfinal fantasyvcsdottreferenceeliteplus/4stellatoolmac plusgenesis pluswindows cesoftwareintroductionassemblersmsspainlisasinclair3dogp32commander keenchip8windowsid softwarefanzinetoshibaquasi88demoplayersc16abandonwarevisual basicpodcastmz-80teolucasartsx1openglcollectionvgbsidmastergbcwikipediatcp/ipaction replayolafnesintellivisionarchimedesemulationpiratesdownloadmultifacecmark3jrpggp2xapple 2gsdocstype-inshopx86bugsinterpretervideohomepagequotesdma designboycott advancelynxgallerypdfti-99/4acamputers lynxconverterstosscansralph baerapple 2z-codewizhucllamasoftgamebasepsionmusicnvggnuboyclubthalionunixcaanooconverteracademichintssovietabc80hitchhikerdoomtgemuhumorjrpgspc-98flashconversionendings6502cheatsportti-89dingooclonesrick dangerousmo6dosboxpinoutspluginbeosmipsromsatarimp3macinfonesqnxscorpionanalysisodyssey2atomgithubcpcsms plusstorykim-1replicasvirtual boycompatibilitybluemsxrainbowmega drivemupenxzxxm7frenchstudio 2zx spectrumaltaircolumnsrecompilerdreamcastpalmostimelinebo zimmermantoolchainn64passwordspc enginemagazinenesterxboxarticleneo geokonamiatari800pc-6000guidesnewsletterbasicsnes9xhandynewslettersi18ndemo scenefeaturearchivedheretictoolsbabygame gearrottmac ospc-fxcalculatoramstradcps2adventure gamesfaqcommercialoricemulatorcomputingunreleasedspace questfm-7streamingcompetitionsaturnbasicnesspecsjapaneseebaywinuaeto8faqsepson3d realmssierrafan gamesphotosmega manimagesaixadventure gamej2meretrodevkegspom1mamefmsxtutorialsgcccolecovisionosf/1open sourcemaniac mansionstrategyjum52gplforummarat fayzullin68kinfocomapogeedemosastrocadephilipstutorialsdktrailblazerdebuggermz-700operating system65816fan fictionexcerptshmupfm townscompilationsiosduke nukemmidirom hackscoversmarcel de kogelguidescummvmx68000david foxagizorkpcsxnet yarozeappleos/2neo4alllibraryfusespectravideosunossc-3000kigbfolkloreacornartworkcasiosgbgremlinandroidsf-7000shmupsdarcnesresourcespspsharpdescentcartridgesbenj edwardshpfpcepatchesascii artlinksms-dosatari 5200cocongpitmartin korthgeocitiesremakescensorshipzopharjumpmanp2000emulatorsculturegizmondorichard bannisterusti-92pc98enginec64psxsam coupĂ©boulder dashcpusegadelphihandheldbbcjswwiki8-bitmastertronicgame boyvic-20ngpczaurusuaenescolemfpgamodsmo5squaresoftmonkey islandvicepowerpcsharewaremz-800vbamanualstandytoshiya takedagamesgiana sistersmastergearusenetmailing listtaitoto7making ofukcreatorscollectingmagazinesdiskmagslittle johnvectrexwscsoundtracksgeneratormtxmike daillyrisc osjeff minternetworkingvaxfirmwarechronologywolfenstein 3daquariusmediac128triviajupiter acefreebsdcharles macdonaldfcednaatari strom hacksnatcherftpfamtasiarpgflyersfujitsuddrcommodoreik+bookreviewspocketpcarcadiasmartphonegifzx81preservationcomicsharvestatari 8-bitindiana jonessolutionshugues johnsonff7interpreterspasopiansfpetps2articlesscummfrodoencyclopediaremakegermanyunderdogsedgeibmtechnotespointlesscompressiongbaonline playapple 1cartridgetnkddjarcadepaul robsongamecubebiosarmtrs-80tvunmaintainedcp/mwonderswansnkitalydragongermanhistory32xpc-88sonicmuleincompleteversionsnintendonamcosg-1000screenshotsnewsmsxrzxcharactershead over heelsthomadswalkthroughcatalogbard's taleluxorron gilbertssemwiisource codeibm pccodeatari steblogfellowflashcartsarstechnicaqlbookscomposersifiandspeopleatari 7800programmingelectronarchivemanualfdswalkthroughsuae4alldatabasepcwfrontiercomputerdownloadsmagickitz80biographysolarismaemoadammerchandiseauctionsradiohexenjapanmagnetic scrollscomputersngcdsupervisionbbc basicmapsgame designxm6scott adamscreativisionrpgssymbiansonysega cdcivilizationhi-scoressmallhardwarecompilerrom hackinggame