famtasia

link thumbnail Famtasia ja translate
NES emulator for Windows with lightgun and FAM ROM image support. From Zophar's Domain:
Famtasia, previously called Famicom, is written by taka2 and nori. It supports the .nes, .fds, and a less common .fam ROM format.

It runs several games and has fair sound support. It also includes configurable support for non standard controllers, such as the light gun. Overall its pre ...
(Added 2006-11-17, 602 hits, more)
link thumbnail Famtasia 5.1 Patch Vending Machine
Download a version of NES emulator Famtasia 5.1 with a custom set of patches applied.
(Added 2006-11-17, 382 hits, more)
Search:

Tags

gamasutracpcfeatureapple 1rpgatari 8-bitvectrexddribmpdffusensfrzxpc-fxadventure gameunmaintainedmartin korthpc enginegallerydiskmagsfinal fantasyftpfanzinengpcjaguarn64apogeejumpmanxzxwinuaeepsonsolutions68kos/2hugues johnsonsymbiandemocompetitionmanualjavap2000italysc-3000sgbsnatchergermanincompletez-coderom listingsadventure gamesgeocitiesnesc16musiccoversdatasheetsblogjupiter acesdlcocostrategypom1windowsmidiporttnkguideanalysisatomcomputingandroidastrocadespecsrom hackingcasiophilipsultimajeff mintercolecovisionhistoryscott adamsgraphicsintellivisionphotossmsfcemagazinesfirmwaredreamcastneo4all3d realmsnet yarozeti-99/4aguidescapcomcompilationsfaqspc98auctionsbbc basicmerchandisetechnotesebaydocsms-dosrotttoshibamo6c128preservationnetworkingsharpstellapluginhppsionfpcejrpgsid softwarenamcosinclairunreleasedcommodoregame boydavid foxkegszorkgremlindosboxmtxapple 2gamebaseatari steflashtosadsarticletranslationsmac plusxm7streaming6502mastertronicwolfenstein 3dhomepagesf-7000kigbmz-800doomyoutubepaul robsonshmupsluxorcaanoocps2unixcalculatortaitowalkthroughspc-6000fujitsuhi-scoresz80tutorialscmo5source codepokescommercialpsxrom hackvisual basickonamiarcadetutorialfrenchgiana sistersjapanmapstype-inatari800little johnasciiartdottddjfmsxinterpreteruae4allemulatorshumorgp2xqlshmupsovietsaturnfm-7snkscummvmnintendoelitesolarisdumpingcompatibilitygithubbeebreferencemagnetic scrollsapple 2gsvideosega cdfrancec64podcastmaking ofjum52toolchainneopoppasswordslinuxcartridgesmessukifgamecubegamesmodscartridgefan artcheatsmonkey islandrpgshexenwinampexcerptrisc osplayersmoviesbbccolemspainromsngparchivedquasi88pandoraarnoldcamputers lynxforumjswwalkthroughtooljrpgemulatorwscj2meencyclopediaedgegbcvicepc-88i18nlynxlibraryarticlesbiosfan fictionreplicasvcsfm townsscummreviewshintsiathalionremixesdingoowikipediatcp/ipflashcartsjapanesemaemoti-89fdsnvgx68000toshiya takedaversionsspritestoolssonysonicmega manmanualsmarcel de kogelgbadragonkim-1idecomputersusenetscansemulationdemo scenecollectingacademicwizpentagonshopneopocottstudio 2atari 7800newsletterzx80msxff7genesis plusmipsmark3gp2xpectrumdnaabandonwarepinoutsneo geosam coupĂ©retrodevtvitcd-iinterviewvaxbo zimmermanwikipatchesmagazinegame geartgemutrailblazerlinksschematicsfinal burncopy protectionrecompilerscorpioninterviewsdemosvic-20charactersaquariusscreenshotsatari 5200tandyx1sms plusto8segarainbowioscensorshippsfharvestcomicscultureimagesplus/4supervisionvgbamigaelectroncpudarcnesfrontierhuccivilizationdelphillamasoftzx81ron gilbertsquaresoftfpgaosf/1maniac mansionhitchhikerclonesbluemsxcodesfcmac osfaqcp/mradioti-92mastergearbiographyxgsxm6hereticremakesgizmondogeneratorsharewarevirtual boyboycott advanceopenglaltairgcc8-bitinstallerscollectioninfonessunosfpsemulemacmega drivehead over heelslucasartsconvertersto7downloadspetmediamp3resourcespointlesswonderswancommander keenassemblerpcwindiana jonesspectravideosnes9xlost sourcetimelineosxmuseummz-700masterhandyik+soundrom hacksbox shotsibm pcgamevideo gamesfreebsdarmps2videoshardwarezx spectrumagidownloadatari stonline playonlinemarat fayzullinbeosusndscolumnsgermanygradiusteocomposerszaurusinterpretersflyersformatsspace invadersspace questqnxgifsciunderdogspowerpcgplfamtasiadtvcastawayarcadiabugscompilerpublisherdebuggeramstradcreatorspspbookbasicnesarstechnicasdkinfocomcharles macdonaldduke nukemboulder dashralph baermamefolklorehandheldfrodoadamcatalogtriviagnuboyoriccopiersascii artolafneschronologycd32xboxsoundtracksnecconsolesgame designwindows ceartworkstoryfellowcreativisionpocketpcmultifacengcd3dopc-98gp32softwarepeoplemike daillyprogrammingoperating systemmz-80richard bannistersmallsidbookssimcoupelisadma designremakepalmospcsxzopharfan gamesbabyenginebard's talevbaarchimedesseriespv-1000thomnewsnewslettersappleendingsacorngrim fandangoconverterabc80mailing listnester65816descent32xbenj edwardspiratescompressionmupenopen sourceodyssey2metal gearpasopiaatariaction replaydatabaserick dangeroussierrauaex86introductionarchivecomputerbasicchip8trs-80ssemaixconversion.netwiisg-1000clubsmartphonemagickitquotes