famtasia

link thumbnail Famtasia ja translate
NES emulator for Windows with lightgun and FAM ROM image support. From Zophar's Domain:
Famtasia, previously called Famicom, is written by taka2 and nori. It supports the .nes, .fds, and a less common .fam ROM format.

It runs several games and has fair sound support. It also includes configurable support for non standard controllers, such as the light gun. Overall its pre ...
(Added 2006-11-17, 561 hits, more)
link thumbnail Famtasia 5.1 Patch Vending Machine
Download a version of NES emulator Famtasia 5.1 with a custom set of patches applied.
(Added 2006-11-17, 352 hits, more)
Search:

Tags

jum52symbianremakepsion3d realmspluginiosshmupspainmoviesinterpreterti-92ibmarticlezx81multifacestreamingjupiter acerisc oscommander keenwindowskonaminewsscansgame boysource codeodyssey2rainbowgizmondomz-700magazineschip8soundtracksneo4allssemvic-20schematicsbox shotspodcastapogeetoolsartworkcd-ioperating systemfm townsvbaasciiartconverterscreativisionscreenshotscaanoomaccomicsarcadekigbmasterscott adamspc98qlgremlinsaturnresourcesz80mo6emulationsdllibraryindiana jonesp2000lynxbeosfolkloreboycott advancearmgbamidimega driveddrmediaedgejswpasopiachronologymaking offeaturepc enginesimcoupegiana sistersmtx6502bluemsxcompatibilitywizjapaneseintellivisionsolutionscartridgevicefaqsexcerpttechnotescartridgespc-fxcomputersintroductionhpvaxunmaintainedrichard bannistersmartphonecolecovisionzx80nsfhexenwinampolafnesc128ftpendingsms-dosebaycharles macdonaldvcssnes9xhandycd32ralph baeragigraphicswinuaexm7hintstvmerchandiseflashcompetitionpokesremixestoolchainlinkspatchesinterviewsassemblerphotosdingoohitchhikerrpgspdfcpasswordsmulesmallcastawayatarimuseumgallerypalmosmipszaurusthaliononlinefpgapcwrzxcomposersgame designvgbarcadiaguidepc-88pv-1000linuxid softwareseriesmailing listik+taitoidepreservationkim-1head over heelstoshibacolemwikibasicpc-6000youtubewalkthroughssf-7000atari 8-bitemulatorsspecsff7sega cdvectrexsmstosbard's talegamasutraneopocottwolfenstein 3dopen sourcespace questfusemega manngcdatari800flyerspsxplus/4doomtutorialspinoutsgame gearfmsxastrocadecpcrom hackssupervisionsoundfaqx68000referencepocketpcharvestabc80newslettersnetworkingtutorialculturemp3magnetic scrollsgamefellowdemocivilizationsgbnecsonicmonkey islandsinclairascii artjrpgxgssms plus3dobookgnuboydma designinterviewmike daillyosxclubaltairshopfcerom hackingxzxmagazineluxorspectravideoapple 1uaedragonunreleasedfrontiergermanypeoplestellaspace invadersfanzinemartin korthti-99/4ageneratorencyclopediadnamarcel de kogelmessstrategyjeff minterosf/1duke nukemn64visual basichereticinterpreterssierranesterclonesradioitx1videocataloghomepageenginemodsarticleswalkthroughti-89rom hacksunosmastergearcopierstoshiya takedaportteollamasoftscummzorksharewaredebuggermupenimagesitalyromsshmupsstudio 2fan gamestriviacpuhucfreebsd68kpetpublisherelitemz-800computerbeebmastertronicboulder dashcps2biographyatari 5200sidsquaresoftrecompilerngpsg-1000spritesddjincompleteos/2timelinezophargbcfpcefranceaction replayjaguarhumorarnoldlost sourcebbc basicc16frenchzx spectruminfocomdiskmagsfinal burnmac osjumpmanwiijrpgsnet yarozeunixprogrammingsolarislisacensorshipgermanmame8-bitsam coupĂ©amstraddemoscp/mfan artdemo scenegamecubereviewsps2wonderswanmsxmaemoadssciretrodevgamestrailblazersc-3000little johnmagickituae4allfrodometal gearcreatorscolumnsdumpingfirmwaregp2xpectrumhistory.netapple 2japanusenetapplepowerpcconvertercomputingc6432xflashcartsqnxpcsxsoftwareemulatorarchiveconsolescharactersultimaibm pcx86quasi88rottxboxatari 7800to8cocoinstallersgenesis plusopengltgemumz-80sfcrick dangerouscompilerfpsebenj edwardsscummvmaquariusrpgthomgradiusgithubphilipsacademicpiratesbiosmapscasiohugues johnsongp32commodorecommercialaixversionsnewsletterpandorareplicasstoryusron gilbertformatsukoricmo5atari stdownloadcapcomgplvideo gamessnatchernesguidespom1scorpionvideoscheatsmusicmaniac mansiondatabasesharptrs-80hardwarenamcoacornconversiongamebasecompressiontoolbookscompilationsanalysispaul robsongcckegsfinal fantasycollectinggrim fandangocopy protectionadamarchivedto7basicnescodexm6dosboxdescent65816ifwsctcp/ippsfcollectionatari stecamputers lynxbo zimmermangiftranslationshandheldadventure gamegeocitiesinfonestandysegasdkj2meneo geopentagondarcneswindows ceremakesdtvdreamcastmac plusjavaiaz-codeforumngpctype-inmark3marat fayzullinbbcnvgfan fictionneopopepsonpointlessdelphidocsfujitsudottelectronrom listingsunderdogsarchimedesapple 2gsfamtasiaatombugsadventure gamesgp2xonline playpspwikipediaarstechnicatnksnkamigaquotesdatasheetssovietdavid foxmanualabandonwarefm-7pc-98virtual boyauctionscalculatorhi-scoressonyfdsplayersblogandroidndsdownloadsmanualsbabylucasartsnintendocoversi18n