emulator

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
link thumbnail BeS9x
BeOS port of Super Famicom emulator Snes9x.
[Source code and a more recent binary can be found at BeEmulated.]
(Added 2006-08-30, 389 hits, more)
link thumbnail BeZX
Sinclair ZX Spectrum emulator for BeOS (x86 and PowerPC), based on XZX.
(Added 2006-08-08, 520 hits, more)
link thumbnail BGB
Game Boy emulator for Windows with high compatibility and excellent debugging facilities.
Features
  • emulation of the GameBoy, GameBoy Color, and Super Gameboy
  • accurate emulation of the hardware, based on research with lots of test roms, useful for debugging/rom development. some highlights:
    • clock exact timing of LCD behavior/state changes
    • reali ...
(Added 2007-09-12, 1282 hits, more)
link thumbnail BioNES ja translate
NES emulator for Windows. From Zophar's Domain:
It's a good emulator, although it is outdated. It features high compatibility, full sound, correct sprite priorities , and most of the mappers fwNES supports.
[Links on the web page don't seem to work; download the binary at Zophar's Domain.]
(Added 2006-11-17, 637 hits, more)
link thumbnail Bleep!
Bleep! is a music player for NSF and GBS files. It comes in two versions:
  • Bleep.exe: Standalone text-mode player for DOS and Win32
  • in_bleep.dll: Input plugin for Winamp 2.x/5.x
(Added 2006-07-06, 410 hits, more)
link thumbnail blueMSX enja
MSX emulator for Windows supporting SG-1000, ColecoVision, SV-318/328, MSX, MSX2, MSX2+, and Turbo-R. Includes a plugin system, debugger, keyboard layouts, and much more.
(Added 2006-07-10, 491 hits, more)
link thumbnail Bochs
The cross-platform IA-32 emulator.
Bochs is a highly portable open source IA-32 (x86) PC emulator written in C++, that runs on most popular platforms. It includes emulation of the Intel x86 CPU, common I/O devices, and a custom BIOS. Bochs can be compiled to emulate many different x86 CPUs, from early 386 to the most recent x86-64 Intel and AMD processors which may even not reac ...
(Added 2003-11-12, 387 hits, more)
link thumbnail Boycott Advance for Mac OS
Mac OS port of Game Boy Advance emulator Boycott Advance.
(Added 2006-08-17, 436 hits, more)
link thumbnail BoycottAdvance ONLINE
Java version of BoycottAdvance.
This Java applet has the power to show off the GameboyAdvance power on a web site. Let people try a beta of your latest game before they can buy it and use it on the real console! Add dynamic content to your GBA web site and let everyone see your nice GBA demos! Turn a sad rom link into a very cool link!
(Added 2003-11-12, 334 hits, more)
link thumbnail BSNES (Mac OS X)
Super Famicom emulator for Mac OS X that focuses on accuracy over performance. No source code provided.
(Added 2006-08-17, 561 hits, more)
link thumbnail C+4 Forever?
Plus/4 emulator for DOS written in assembler as well as some file conversion tools. Source code available.
(Added 2006-09-03, 368 hits, more)
link thumbnail c64psp
PSP port of C64 emulator Frodo. No source code provided.
(Added 2006-08-14, 354 hits, more)
link thumbnail Caprice32
An Amstrad CPC emulator for Windows.
[Homepage not reachable; this entry points to SourceForge project page.]
(Added 2004-06-28, 391 hits, more)
link thumbnail Castaway
Atari ST and 68k emulator for Linux, Windows, and other systems for which SDL is available.
(Added 2006-08-17, 455 hits, more)
link thumbnail CastCE
Port of Atari ST emulator Castaway for PocketPC that runs at full speed. Source code is available at the (live) Castaway web site.
(Added 2006-08-17, 384 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
Search:

Tags

archimedesmidinetworkingmike daillygrim fandangofeatureidefpgahead over heelssnatcherzx spectrummz-806502videosindiana jonesrottcpuvirtual boytoshibacatalogz-codeauctionspc98asciiartexcerptrainbowabandonwareatari 8-bitngcdpasswordswinuaeemulationtgemumipsunreleasedendingsconversiontype-inc64duke nukemdtvtaitoandroidcopiersversionsdescentmanualssdkz80iflisastoryj2mewindows cerom listingsshmupspaul robsongiana sistersgamebaseik+archivedgermanflashcartsjapanjrpgsguides.netsdlcommercialdiskmagscamputers lynxtoolstandycharactersnvgsam coupĂ©atomvisual basichexentranslationsmo6quasi88cp/madsonlineunderdogspowerpcron gilbertsnksimcoupe3d realmssoftwaremasterarnoldgeneratormark3pc-6000moviesreviewsfujitsufan fictionformatsportkigbrom hacksthalionos/2fmsxvectrexfrancepcwto8videomerchandiseyoutubesource codedarcnesdemosoundmuseumacademiciosintellivisionmagnetic scrollsscreenshotsi18ngnuboygame geartrs-80calculatorflyersfan gamespentagonadamcomicsacornhardwarewalkthroughspecstimelinedragonhintskonamiscummhi-scoresiagallerypiratesdavid foxsinclair8-bitfamtasianewslettergamesimageshistoryjavaconvertersdumpingultimarisc ossidcolumnsmo5pandoragbagifthomgeocitiesdocsaquariusscott adamsunixlost sourcebbc basiccodesgbatari 7800bard's taleqlarcadiaxboxbiographyforumrom hackdownloaddelphiti-89marat fayzullinboulder dashmz-800applemupensunosromscd-in64vaxspace questmagazinescastawaygermanyvideo gamesretrodevresourcestvwikiuscomputerssharewarewikipediaosxfdscensorshipgame designcartridgespom1qnxssemzorksmallgp32remakescbabyconverterrzxosf/1gplchip8faqsinstallerscaanoomacsaturngamecubemessx86mapsprogrammingsegaaixdotttechnotescommander keenbasicnestcp/ipgamasutraibmnet yarozeschematicslibraryelitexzxastrocademac plusitcommodorecocomtxff7making ofcivilizationralph baeronline playlinuxpreservationartworkbasicneswonderswancollectionpc enginepc-88trailblazerfaqcps2infocomcd32pocketpcamstradseriesblogclubgp2xplayerspeoplevcsfanzinemagickitkegsapple 1japaneseoricuaejum52monkey islandpsfarticlesdebuggersf-7000scorpionsolutionspc-fxgamedemo scenemediams-dossharpunmaintainedbeosenginec16apple 2gsdingoopc-98ukbooksdoomrichard bannisterarstechnicaatariddrhandheldpdfmartin korthfinal burnvbaaltairarmbo zimmermansovietrom hackingx68000italypv-1000sfcbiosdreamcastpalmosepsoncoverscpcoperating systemsmartphonewiineopopshmupsierraebayarticlejumpmanzx80jupiter acerick dangeroussonystudio 2fm-7compatibilityzx81tutorialsfrenchjswgradiuspublishernectnknintendoti-92gp2xpectrumps2fusepinouts65816hitchhikerquotesjrpgatari stemz-700computerplus/4zaurusmuleremakehomepagemastergearatari800hugues johnsonstreamingspace invaderssciascii artxgstosrpgpodcastpspatari stsnes9xopen sourceinterviewnsfarchivenewsapogeemusicsoundtracksassembleratari 5200lucasartsarcadewolfenstein 3dwizgenesis pluswscinfonesfrontiermailing listclonesjeff minteribm pcbluemsxmetal gearfirmwareteofan artsc-3000mastertronicradiolittle johnpluginaction replaygame boyguideftpmsxagisolariscapcomtriviangpwinampneo4allinterpretershopcollectingpsiondma designgraphicshucpcsxfreebsd3dopatchessms plusbox shotsolafnesngpctoolmameabc80remixesxm7cartridgehpdatasheetssupervisionchronologylynxcolemcomputingcharles macdonaldndsmega drivecolecovisionpetp2000marcel de kogelsonicneopocottstella68kfolklorecreativisionopenglwindowsmac oscreatorsodyssey2fcespectravideoreplicascomposersadventure gamellamasoftuae4alldnadosboxddjbeebcasiogizmondocheatswalkthroughstutorialintroductionapple 2toshiya takedagcczopharculturereferencesg-1000mp3githubbugsfpcephotostoolchainsquaresoftinterviewsnamcospritesstrategyamigamultifaceneo geojaguarpointlesspokesbenj edwardsfm townsfrodoluxorscansxm6maemogbcencyclopediahereticc128recompilerflashanalysisharvestdatabaseemulatorfinal fantasy32xpsxlinksx1interpreterselectronconsolesrpgsgremlindownloadsadventure gamesscummvmcompilermagazinemega mannewslettershumorsega cdcopy protectionvgbemulatorsmaniac mansionvicesymbianphilipsfellowboycott advancecompetitiondemosusenetfpseid softwareto7compressionvic-20bbcpasopiati-99/4aincompletekim-1spainhandymanualbookmodsnesteredgecompilationssms