emulator

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
link thumbnail uBee512
Open-source Premium Microbee 512K FDD emulator for Windows and Unix.
uBee512 emulates all of the Microbee Z80 series of microcomputers, including ROM, Floppy and Hard disk-based models. Up to 2MB of extended memory is supported. The optional on board sn76489 sound IC is also emulated. The display may use SDL or OpenGL video rendering. Z80 PIO emulation includes tape, speaker, RTC, ser ...
(Added 2007-08-27, 211 hits, more)
link thumbnail UberNES
NES emulator for Windows with hi-score tracking, advanced ROM browsing, debugger, and other features.
[The GPL'd and highly portable emulator core source code used to be available for download here, but has since been removed. It can, however, still be found at the Internet Archive.]
(Added 2006-11-25, 174 hits, more)
link thumbnail Ultimate NES
Incomplete and thus grossly misnamed NES emulator for DOS.
[Entry points to emulator archive at Zophar's Domain.]
(Added 2006-11-26, 217 hits, more)
link thumbnail uNESsential
Unmaintained and incomplete NES emulator written in QuickBASIC.
(Added 2006-11-26, 201 hits, more)
link thumbnail unofficial nester
NES emulator for Windows based on nester with some added features.
[Source code is included in the binary download.]
(Added 2006-11-26, 325 hits, more)
link thumbnail Unreal Speccy
ZX Spectrum/Pentagon emulator for Windows.
(Added 2006-09-22, 315 hits, more)
link thumbnail UNZ ja translate
An FM Towns/Marty emulator.
(Added 2004-01-28, 1253 hits, more)
link thumbnail uosnes ja translate
Enhanced version of Snes9x for Windows and Linux emulating a Super Famicom with the Bandai Sufami Turbo accessory.
(Added 2007-06-12, 884 hits, more)
link thumbnail UQLX
Sinclair QL emulator for X11.
UQLX is a software emulator emulating a Sinclair QL on Unix/X and similar systems.

UQLX is now in late alpha stadium, it deals very well with most QL software and works on most Unix-like architectures. Emphasis is to achieve useful integration of modern QDOS into Unix/X environment but also runs many old games.

...

(Added 2003-11-12, 349 hits, more)
link thumbnail V2600
Atari 2600 emulator for RISC OS.
(Added 2006-08-17, 189 hits, more)
link thumbnail VB64
Commodore 64 emulator written in Visual BASIC.
I chose to write an emulator in VisualBasic as a technical experiment into the power of VB.
(Added 2007-01-30, 324 hits, more)
link thumbnail VB81 XuR
Extended version of Windows ZX81 emulator VB81.
Primary designed to had New functionalities in vb81 (screen shot and Zx81 programmers tools...), this release isn't really an Vb81 update, but a Vb81 Toolbox.
(Added 2006-12-23, 201 hits, more)
link thumbnail vbSpec
Spectrum emulator written in Visual BASIC. Source code available.
(Added 2006-08-17, 188 hits, more)
link thumbnail Vecx
GCE Vectrex emulator for Mac OS. No overlay support.
(Added 2006-08-17, 379 hits, more)
link thumbnail vGBX
vGBX is an open-source Java Applet that emulates the Nintendo Game Boy (GB) and Game Boy Color (GBC), released in 2010. vGBX is a fork of the excellent JavaBoy by Neil Millstone, which was in development from 2001 to 2005. Most of the differences between vGBX and JavaBoy are interface-related, code cleanup, and fixes for issues that popped up in newer versions of the JVM.
(Added 2013-01-16, 597 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
Search:

Tags

mp3spritesimagesgeneratorrpgsacorngamekim-1maemographicssovietbox shotscoverspcsxpointlessblogzx81darcnesatarigradiuspc-6000richard bannistergp2xhitchhikeribmrom hackosf/1toshiya takedahardwareibm pcarchive3d realmscd32ngpunderdogselectroninterpreterzauruscomputerwizenginerottsource codecommercialmega man6502githublucasartsemulatorsdreamcastaltairjrpgcreatorscartridgecp/mgplaquariusfuseddrspectravideomac osneopopmagickitgeocitiessonyspainsnkpokespsftoolchainmerchandiseschematicsi18nvirtual boyusitwalkthroughsarchimedesplugindemo scenereferenceremakeswscinstallersmartin korthsharewarebeoslittle johnc128italyexcerptarcadiallamasoftpodcasthpcolumnsinterviewuaemastersnes9xbbcatari 7800magnetic scrollsdottftpx1tutorialngpcmetal gearpdfgame gearunreleasedopenglatari 8-bitdebuggercomputingasciiartscummdavid foxpc-88rick dangerousresourcesbasicnesxm6apple 1fm-7tutorialsremixespv-1000smallhintsbard's talejavagame boyj2mehandyabandonwaregiffmsxflashsgbincompletemarat fayzullinjrpgstandymediaradioendingsidenewsrpgmaking ofmz-800codeandroidnintendoscott adamsmz-80caanoomagazinesstrategydiskmagszopharintroductionnecflashcartsunmaintainedgamesinfonesformatsmanualsfan gamessolarisforumwindows cefujitsufaqssoundtrackscompilationsfolklorep2000giana sistersemulatorcomputersuae4allz80censorshipnamcowolfenstein 3dcompatibilityaixgamecubefrodoiosmarcel de kogelthalionstellasaturnadventure gamesfrontierdnaphilipsgremlinron gilbertcompressionti-99/4aretrodevsidlinksxzxscorpiongbctrs-80capcompinoutsartworkfrenchosxolafnesifopen sourcec64babyjapandownloadscartridgesedgenewsletterngcdsega cdfpsephotosfanzinepasopiaacademicpc-98benj edwardspowerpcsg-1000plus/4programmingxgsrom hacksfaqscreenshotssmartphonehistoryvisual basicvgbdosboxonline playplayersmoviesgame designneo geofan artgp32ndschip8descentbiographywonderswanpocketpcconverterrom hackingclubcopy protectionpetti-92mastertronicsc-3000mapsapogeecpudocswikikonamiinterviewsdatasheetspublisherteowindowsrzxluxorcharles macdonaldsupervisionseriesnvgepsonapple 2toshibamusicpaul robsonpsionc16ti-89space questfranceatari 5200ebayfpcesquaresoftpreservationversions8-bitfcemaniac mansionrainbowromsgp2xpectrumtnksoundwinamptoolssf-7000nesremakegnuboybbc basichexen3doultimalost sourcesymbianatari800atari stehugues johnsonnetworkingmo6dma designbugsmultifacehucbo zimmermanos/2ssemmark3characterssfcunixtranslationslibraryspace invaderszx spectrumgermanysharpreplicascomicsreviewsmsxatari stsnatcherlinuxvcsid softwarems-dossoftwarejumpmanusenet65816culturecd-idtvsdlmuleaction replayamigapc enginen64collectionpsxduke nukemflyerspatchessam coupĂ©beebmailing listshmuprom listingsabc80humordatabaseyoutubejupiter acemz-700jaguarbooksnet yarozebasicjum52zx80hereticfinal burnintellivisioninterpretersstorycopierspalmosguidescataloganalysisgccsciboycott advancemipsz-codecompilermacchronologyddjonlinetosdragoncheatsfdstaitojswcommander keenmuseumgallerymameassemblercollectingsinclairgbaapple 2gsarmjapanesepeoplearticlesqnxrisc oselitetype-insegaastrocadecivilizationpasswordssmssunossdktcp/ipgamasutratgemuclonesagicreativisionhomepagepsparticlewikipediaxboxpom1vaxcompetitionpentagonadscpcfm townsps2simcoupefan fictionfpga.netbook68kdelphioricamstradgamebaseiaxm7consolesmac plusauctionswalkthroughmo5piratespandoracasiomidivic-20composersgizmondosoniccocoapplehead over heelstrailblazertoolbiosindiana jonesfellowadamsierramtxfamtasiacamputers lynxoperating systemencyclopediawinuaemodskegsarnoldnsfharvestcastawaytimelinemike daillytriviax68000pcwrecompilerlynxdingoobluemsxcportdoomquasi88wiisolutionsthomarstechnicacps2mastergearmega drivecalculatorhi-scoresmesszorkconversionlisascansto7dumpingnewslettershandheldadventure gamespecsguidefinal fantasyfeaturetvvectrexinfocomjeff mintermonkey island32xatomfreebsdkigbvideoascii artscummvmgermanconvertersshoppc98sms plusff7neo4allvideosneopocottdownloaddemodemosik+archivedodyssey2grim fandangoemulationfirmwarecommodoremupenstudio 2manualvbax86technotescolemralph baerboulder dashqlcolecovisionarcadegenesis plusnesterviceto8quotesshmupsstreamingmagazineukpc-fxvideo games