emulator

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
link thumbnail TGEmu for Mac OS
Mac OS port of PC Engine emulator TGEmu. No source code provided.
(Added 2006-08-31, 484 hits, more)
link thumbnail Thom fr translate
Thomson TO7-70 emulator for DOS, Linux, and Windows.
L'émulateur TO7-70 original de Sylvain Huet présentait quelques imperfections, notamment au niveau de la temporisation et de l'émulation sonore. Une refonte m'a donc semblé nécessaire et elle a été l'occasion d'ajouter une interface utilisateur plus conviviale. Initialement développé sous MSDOS et Linux, Thom a ensuite ...
(Added 2006-09-17, 729 hits, more)
link thumbnail Thom for Mac OS
Mac OS port of Thomson TO7 emulator Thom.
[No source code provided.]
(Added 2006-09-17, 423 hits, more)
link thumbnail TI-99/Sim
Open-source TI-99/4A emulator.
At first is was a simple text-based simulation of the TI. Then I added graphical support for the OS/2 Presentation Manager. When I got bored with that, I ported it to Windows and added sound support. Now I've decided to try my hand at a Linux/cross-platform version. In the spirit of Linux and Open Source, I'm releasing the code under the GPL license....
(Added 2003-11-12, 406 hits, more)
link thumbnail TiEmu
Open-source TI-89, TI-89 Titanium, TI-92, TI-92+, and V200PLT emulator for Linux, Mac OS X, and Windows. Supports debugging with GDB.
(Added 2006-11-15, 527 hits, more)
link thumbnail TilEm
Open-source Z80 TI calculator (73, 82, 83, 83+, 83+ SE, 84+, 84+ SE, 85, and 86, but not the TI-81) emulator for Unix and Windows supporting and all known ROM/OS versions.
(Added 2006-11-15, 367 hits, more)
link thumbnail Timex/Sinclair 1000 Emulator
This is an emulation of the Timex/Sinclair 1000 (a.k.a. Sinclair ZX-81) home computer. If the emulator does not respond when you type, try clicking on the emulator's window.
(Added 2005-12-27, 386 hits, more)
link thumbnail TinySID
The world's smallest SID file player, for Windows, Linux, Mac OS X, PSP, and Rockbox.
(Added 2008-01-15, 515 hits, more)
link thumbnail TNES
NES emulator for DOS with a solid feature set.
This emulator is by Paul Robson of GB97, NESA and A26 fame. It has much better mapper support than NESA did. It also has Game Genie support, joystick support and on-the-fly saving. The sound is emulated through Adlib. It hasn't been updated since its first release, so the future looks grim for TNES.
[Entry points to emulator ...
(Added 2006-11-25, 202 hits, more)
link thumbnail ToDC and ToPS2
Ports of TO7-70 emulator Thom to Dreamcast and PlayStation 2.
[Downloads have been archived. No source code provided.]
(Added 2006-09-17, 455 hits, more)
link thumbnail Turbo Engine 16 (AamirM's Home Page)
Turbo Engine is an accuracy focused emulator which can emulate the following NEC console systems with very high degree of accuracy:
  • PC Engine / TurboGrafx-16
  • SuperGrafx
  • CDROM² / SuperCDROM²
Due the way Turbo Engine emulates the hardware, the system requirements to run games fullspeed are a bit high. This issue is being addressed by optimiz ...
(Added 2012-10-08, 145 hits, more)
link thumbnail TuxNES
[A]n emulator for the 8-bit Nintendo Entertainment System. Currently, the emulator has been tested on Linux, FreeBSD, and NetBSD, all running on i386 processors.
[...]
TuxNES is based on Nestra, a great public-domain NES emulator by Quor.
(Added 2003-11-12, 366 hits, more)
link thumbnail UAE4ALL
Port of Amiga emulator UAE for Sega Dreamcast and Dingoo. Versions for Windows and Linux are also available.
(Added 2006-08-30, 418 hits, more)
link thumbnail UAE4ALL Gizmondo Port
Port of Amiga emulator UAE4ALL to the Gizmondo.
This version shares the same codebase as uae4all gp2x 0.6.3, including the FAME/C core that the mighty Chui provided. Sound works now.
(Added 2006-08-30, 588 hits, more)
link thumbnail uae4all gp2x
Port of Amiga emulator UAE4ALL to the GamePark GP2X.
(Added 2006-08-30, 763 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
Search:

Tags

genesis plusspecsthomasciiarttaitocoversendingswindowsdescentdownloadsqladventure gamesqnxtvabandonwareadventure game32xsinclairfcetoolsrisc osgifgp2xpectrumwizlisascummngpcssembookpointlesszx80dosboxascii artnetworkingopenglinfonesreviewspc-98blogiamega manvbasc-3000gameapogeenewslettersbookssquaresoftsonicexcerptifmastertronicfuseonlinebasicnesgraphicsc16vaxapplejumpmanharvestindiana jonesmodssmallmz-80firmwaretoshiya takedadumpingunderdogsgnuboyformatsanalysistranslationsgithubspainviceelectronff7sharpsf-7000mz-700programmingintellivisionsupervisioncamputers lynxmartin korthaltairfpgamagnetic scrollsmaniac mansionunreleasedosxatari 5200pdfbiographyconverterfolkloreauctionsarnoldhitchhikerdreamcastmac plusron gilbertlittle johnastrocademusictoshibavideosonline playscorpion6502sgbpc-88civilizationunmaintainedfrontiern64clubplayersreferencendssnes9xgbato7type-invirtual boydebuggerdemophilipskegsflashatari steosf/1palmostechnotesandroidpc-6000ukacademicvectrexsnkmidiralph baerboycott advancerom hackszorkgame designrom hackbbcsolutionscaanoodemo scenestellaarcadiazopharfmsxbeebbluemsxcomicsps2hexenreplicasgamesmike daillycommercial.netx86linksportolafneshugues johnsontrailblazermarat fayzullinpsxseriesdiskmagsos/2pc98multifacepc-fxti-89featurellamasoftfm-7pom1censorshipfan artarchivedguideshmupguidesemulatorjrpgmz-800remakesquasi88box shotsgpldna65816elitesoundtrackspluginrzxmachpultimakim-1mediacp/mquotesvisual basiccamstraddottwalkthroughgamecubemaemozx spectrumsunosepsonmetal gearapple 1open sourcespritescompatibilitysfcpspcolemarticlesfpsestoryinterpreterspatchesgizmondoarstechnicawikipediaflyersatari 7800javapsfmaking ofitatari800c128flashcartsaction replaydownloadbabyduke nukemcastawayngpcatalog8-bittoolshmupsamigaddrmailing listinfocomshopnesgeocitiescolecovisionmupendatasheetsgp2xmanualz-codegame boyrichard bannisteruae4allebayfrodosierraddjscioricfinal burnzaurushead over heelsgrim fandangofamtasiamac osedgewikipasswordscopierscomposersintroductionmsxatarisaturnnewslettermega driveodyssey2computeradamromsbiosdocsencyclopediamagickitneo geocapcomabc80enginewindows ceftpfrenchcommodorefaqinterpreterscreenshotsarcadefinal fantasyaquariuspsionversionsconsolesxgsdma designgbcwinuaejswbasicmasterpc enginesource codecd32gp323d realmsnvgxm6nsfneopocottnesterthalioncalculatordtvsidartworksdkscanshomepagemagazinejapanhistorypcwsam coupécartridgeslucasartstnktgemugradiuslost sourcewonderswanhardwareinstallersatomcartridgeinterviewspetmipsnecmamesdlemulatorswinamplynxibm pcdingooscott adamsoperating systemjaguarjrpgscd-ipentagonj2mesoundfpcebbc basicms-dosdoomtoolchainkigbhintsagigeneratorcps2podcastneo4allschematicsaixcompilerrpgsx68000interviewclones68kassemblerfm townspasopiamarcel de kogelgremlinconvertershi-scoresmo6bugsplus/4resourcesrpgjapaneseteosmssymbiancasiokonamispace invadersrick dangerouswsccreatorsjum52archivepaul robsonitalytutorialmulecommander keenfaqsgalleryti-99/4awalkthroughssoftwarepublishervideofrancepokesmerchandisecollectionpreservationmanualsnintendomonkey islandik+gccdelphisegaatari stxboximagesz80idewiisms plusmessvcsarmdragonngcdrecompilersovietcolumnsdatabasespace questradiostreamingremakemp3cpcsg-1000fanzinedavid foxpandorap2000demosti-92chip8germanyid softwaremoviesconversioncodenamcoacornsimcoupedarcnesusenetnewsscummvm3doxm7adshucpcsxgermanarchimedesmtxpiratesfan fictionvgbcheatssmartphonejupiter acezx81ibmcompetitioncultureboulder dashemulationcputossnatcherheretictutorialshandheldsolaristrs-80vic-20creativisioniosfreebsdmo5to8fdsc64game gearhandywolfenstein 3dxzxlinuxcomputingmark3rom listingsluxornet yarozebeosfujitsuremixesuscompressionincompletejeff minterlibrarycollectingvideo gamescocosega cdtimelinepv-1000charles macdonaldforumbard's talei18ncopy protectionatari 8-bitmagazineshumormastergearpeoplepocketpcgiana sisterspowerpcrainbowrom hackingstrategyx1bo zimmermanphotostcp/ipsonytriviauaefan gamesretrodevarticleapple 2gscomputerscompilationsunixapple 2tandysharewaremuseummapsgamebasegamasutrayoutubefellowpinoutsrottchronologyspectravideoneopopcharactersbenj edwardsstudio 2