emulator

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
link thumbnail Soviet PC enru
Korvet PEVM emulator for Windows.
win32-only, FIRST-generation emu-core (w/o scripts, but this is (not) only release with support of savestates currently)
was based on Korvet-specific core, partially redesigned to support emulation of other PC-s (x86-16/32 at least)
(Added 2007-06-12, 519 hits, more)
link thumbnail Soywiz's PSP Emulator
Soywiz's Psp Emulator is a psp emulator developed with a TDD approach for PC made in C# 4.5.
(Added 2008-04-03, 252 hits, more)
link thumbnail SP48
Very simplistic Spectrum 48K emulator for MS-DOS written in assembler.
Some friends asked me to put my speccy emulator on the Web, so here it comes. Please keep in mind that it is not a fully released version because I never finished it. There is a lack of many, many features, but the Z80 emulation kernel is 100% done and lots of games are playable. A 386+ is required beacuse the kern ...
(Added 2006-08-30, 207 hits, more)
link thumbnail SPEC
Spectrum emulator for MS-DOS (freeware) and Windows (shareware).
[The registered version can not be bought anymore, unsurprisingly...]
(Added 2006-08-31, 429 hits, more)
link thumbnail Spec128
Spectrum 128 emulator for RISC OS.
Spec128 is a ZX Spectrum 128 emulator for the Acorn. There's currently no shortage of 48k Spectrum emulators for the Arc, but there are only two other Spectrum 128 emulators, and both are commercial. Spec128, however, is freeware.
(Added 2006-08-31, 249 hits, more)
link thumbnail SPEC256
Pseudo-Spectrum emulator for Windows that simulates a Spectrum with 256-color graphics. The web site also provides a couple of games with souped-up graphics for download.
(Added 2006-08-31, 256 hits, more)
link thumbnail Speccy
Sinclair ZX Spectrum 48, 128, +2, and +3 emulator for various platforms.
(Added 2006-08-31, 271 hits, more)
link thumbnail Spectemu
A Sinclair ZX Spectrum emulator for Linux/Unix.
It emulates the Z80 processor as well as the 48k Spectrum's other hardware: keyboard, screen, sound, tape I/O. The emulation is very close to the real thing, but it is still quite fast (It was reported to be working well on a laptop with 486 at 25Mhz!).
[The SourceForge re ...
(Added 2003-11-12, 210 hits, more)
link thumbnail SPECTRUM (Pedro Gimeno's Spectrum Page)
MS-DOS Spectrum 16K/48K emulator, plus other interesting Spectrum downloads.
(Added 2006-08-17, 190 hits, more)
link thumbnail Spectrum Emulator for Java
Simple Public Domain Java Spectrum emulator.
You should consider this to be a neat toy, not something which you would expect to actually work. There are a few bugs still in the CPU code, and a group of instructions are not emulated yet. This means that a lot of games will just crash. You can play simpler stuff like the "Horace" games just fine, though.
(Added 2006-08-31, 188 hits, more)
link thumbnail SpectrumAnyWhere enes
Spectrum emulator for Windows and Windows CE 3.0.
(Added 2006-08-17, 402 hits, more)
link thumbnail SquidgeNgine
PC Engine emulator for GP2X without sound support.
(Added 2007-06-12, 541 hits, more)
link thumbnail SSEM-Mac
SSEM-Mac is an application emulating the Small-Scale Experimental Machine. Also known as the Baby, it was the first computer to run programs stored entirely in memory. SSEM-Mac requires any PowerMac to work, Appearance and 2 mb of RAM.
(Added 2012-11-25, 251 hits, more)
link thumbnail SSF ja translate
High-compatibility Sega Saturn emulator for Windows.
(Added 2006-10-09, 601 hits, more)
link thumbnail ST Disk Detective
Atari ST emulator frontend for Windows supporting STeem, WinSTon/STew, and SainT that makes it easier finding and playing specific games on the common Atari ST compilation disks.
(Added 2006-09-07, 194 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
Search:

Tags

shopsimcoupesnatchersf-7000konamicataloggbamsxmac osmastertronicneo geofceremixesbenj edwardsreviewsinfocompc-6000compilationsmailing liststrategyprogrammingculturefmsxtutorialstutorialgccgifnesterhandymaemodatasheetsneccharactersendingsadventure gamemagnetic scrollsiawinuaeultimaatari800geocitiesff7intellivisionfirmwaremagazinestnkdreamcastexcerptatari stonline playauctionsfrodoedgejavanewsscott adamsps2archimedesgameamigarom hackmasterguidesfan gamesjumpmancpctoolsdragonunmaintainedconvertersngcdaixneskegsversionsarcadiasms plusibmj2mezx spectrumdnapodcastanalysiscopierssoundcompatibility6502final burnsinclairblogcalculatorcartridgescreatorsgame designrom listingsinstallerssolarisunderdogsuae4allbeebzorktechnotespasopiasfcbooksarchivecomposersplayersbox shotsassemblerluxorrom hackscensorshipmediaxboxmanualsbookngpmulecamputers lynxinterviewsfellowlynxx1famtasiatrailblazerreplicaszx81astrocadesource codefrontierbbcunreleasedhead over heelswinampdemoti-89fan fictiondavid foxcheatsvgblittle johnmega drivefdsnet yarozespainthalionti-99/4apc-98guidellamasoftarchivedsc-3000stellatcp/ipwikitosopenglmacpsxndstype-inwikipediapspvideo gamesn64atari 7800fpgac64videosconversioninterpretermarat fayzullinadsebaydocsvicediskmagsosf/1resourcesascii artzopharformatshucpethardwaremaking oflinkssgbpaul robsonarticlepom1itpalmoshugues johnsonarcadedescentssemgrim fandangoxm7ralph baerbard's talemupenandroidbiospreservationrottsegahexenlinuxi18nwonderswanfan artboycott advancestudio 2japanx68000pcwqnxwscboulder dashvbagp32abandonwaregermancp/mmodsitalyagitandyfeatureconvertercomicsengineelectronpublishernewsletterflashgeneratorz80retrodevlibrarysmartphonelost sourcepasswordsddr3dohandheldsquaresoftc128articlesneo4allcodeaquariuspointlessemulatorjupiter aceschematicsjum52symbianosxfrenchtimeline68kcasioatari stemanualmagazinesnes9xflyersneopocottdelphigradiuscommander keenvisual basicintroductionrpgsbasicto7gamesdownloadpsiongp2xpectrumscicoversto8compressionthomcd32translationsamstradhistorypluginmastergearmarcel de kogelmartin korthz-coderick dangerousbugsvirtual boycompilerpentagonpatchesifspecsinfonesfreebsd3d realmsgithubgremlinphotosimagesharvestchronologyhumorfranceacornsupervisiontgemuzx80piratesdemo scenemerchandiseik+kigbqltoshibauaeddjdatabaseforumc16orichereticsoftwarewindows cearnold32xhi-scoresapple 2gnuboynetworkingsolutionsstreaminggame gearpc enginemark365816walkthroughmipsjrpgsadamcollectionpc-fxnewslettersoperating systemnsfcomputingvic-20triviagermanyidealtairmamefaqstrs-80pc-88peopleapogeeatari 5200seriesfusegallerybo zimmermanlucasartsftpdingoosdkvaxsaturnnamcopowerpcpinoutsfujitsumidiromswalkthroughsmz-700bbc basiccommodorefinal fantasyron gilbertwizfanzinespace invadersjeff mintercomputersconsolescocoabc80chip8scorpionbluemsxgamecubemp3referencewiiscummms-dossharpcommercialmonkey islandfpsejapanesedtvjaguarrichard bannistermetal gearpokeshomepagesg-1000rainbowfm-7vectrexmega manartworknvgscreenshotssam coupĂ©jrpgdosboxmtxclonespandoramagickitopen sourceusenetxgspcsxcps2computeraction replayuksnkplus/4fm townssoundtracksteofpcefolkloremapsti-92dottgame boyatommusicjswcolumnsasciiartcportvideogamebasecolecovisiongplclubemulatorscartridgehitchhikercolembeosquasi88p2000usradioiosstorycopy protectionapplesmallneopopspectravideopsfsovietmultifacecivilizationmessdoomelitexm6taitomo5id softwarecollectingodyssey2rzxrom hackinggiana sistersmike daillysierradownloads.netsmspv-1000scanswolfenstein 3dnintendoos/2academicmo6shmupssega cdduke nukemfaqquotesflashcartsarstechnicapocketpccapcomunixmaniac mansionencyclopediasunosepsontoshiya takedacharles macdonaldgbcmoviesindiana jonesbasicnesbiographydemosrpgarmsonyadventure gamesmz-800windowsgenesis plusinterpretersmac plusphilipskim-1cputoololafnesapple 2gs8-bitgraphicsonlinecd-iatari 8-bitsdlvcshintscreativisioncaanooshmupincompleteapple 1youtubepc98remakemz-80pdfgp2xrecompileribm pcemulationatarigizmondospritesrisc oslisainterviewcastawayzaurussharewaredma designsidngpcspace questremakesbabyxzxscummvmgamasutradarcnestoolchainhpcompetitiondumpingmuseumtvdebuggerx86sonic