emulator

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
link thumbnail PocketUAE
Port of Amiga emulator UAE to PocketPC.
Here are some of the supported features:
  • support for up to 4 Floppy Drives
  • 68000/010/020/040 CPU, optionally a 68881 FPU
  • OCS, ECS and AGA Graphics Chipset (including sprite-playfield collisions)
  • Up to 2MB Chip RAM and up to 8MB Fast RAM, or 8MB Chip RAM without Fast RAM
  • Up to 64MB Zorr ...
(Added 2006-08-17, 625 hits, more)
link thumbnail Pom1
Portable Apple I emulator.
Pom1 is an Apple 1 emulator and is being ported to C from the original Java version. It uses the Simple DirectMedia Layer library and works on most platforms.
(Added 2007-05-17, 468 hits, more)
link thumbnail Project 51
NES emulator for DOS with sound but limited mapper support.
[Downloads have not been archived; get them at Zophar's Domain.]
(Added 2006-11-25, 299 hits, more)
link thumbnail Project M88 ja translate
NEC PC-88 emulator for Windows.
(Added 2007-06-10, 813 hits, more)
link thumbnail Project X88000 ja translate
X88000 emulator for Windows and Linux/x86.
(Added 2003-11-12, 703 hits, more)
link thumbnail ProSystem
ProSystem is an emulator for the Windows operating system that will allow you to play Atari 7800 video games on your PC. [...]
The ProSystem emulator was written in the C/C++ language and uses the Windows API and DirectX to help emulate the display, sound and input. It emulates both the NTSC and PAL consoles. Please see the documentation for a description of the other features....
(Added 2007-06-10, 431 hits, more)
link thumbnail Psion Organiser 2 Emulator
This is an accurate machine code (6303) level emulator for a variety of Psion Organiser 2 models, starting with the simplest 2 line display with 32k ROM building up to the 4 line display with up to 64k ROM and 96k RAM.. Writing support for Datapaks, and support for larger datapacks is to be provided at a later date, and there is an integrated HD6303X debugger (pictured). The emulator i ...
(Added 2012-11-26, 387 hits, more)
link thumbnail PSP Player
Unmaintained and incomplete open-source PSP emulator written in C#.
(Added 2008-03-26, 291 hits, more)
link thumbnail PSP-UAE
PSP port of Amiga emulator UAE.
(Added 2006-08-20, 387 hits, more)
link thumbnail PSPAtari
Port of Atari 800 XL, 130 XE, and 5200 emulator Atari800 to the PSP.
(Added 2006-08-20, 410 hits, more)
link thumbnail PSPBEEB
PSP port of BBC Micro emulator BeebEm. Source code available.
(Added 2006-08-20, 317 hits, more)
link thumbnail PSPCAP32
PSP port of Amstrad CPC emulator Caprice32.
(Added 2006-08-20, 352 hits, more)
link thumbnail PSPColem
PSP port of GPL'd Colecovision emulator Colem.
This version supports IRDA-Joystick box designed by my good friend Buzz.
(Added 2006-08-21, 374 hits, more)
link thumbnail PSPectrum enes
Spectrum emulator for PSP. Source code available.
[Note that the archived site linked to does not provide the binary. There is, however, an older version that does.]
(Added 2006-08-21, 327 hits, more)
link thumbnail PSPInt
PSP port of GPL'd Intellivision emulator Jzintv.
(Added 2006-08-21, 276 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
Search:

Tags

culturej2meapple 2gamecuberadiospace invaderswalkthroughsmartin korthneo geoboycott advancelittle johnpetzaurusos/2fan gamesfpcewindowsgp2xpectrumfcebard's taleinterpreterxm6action replaycatalogplus/4scummremixesfujitsucapcomsymbianportsierracompressionrom hackstechnotesdescentarmlinksdocsrick dangerousfm-7abandonwareiacollectingkonamielitehistorymidiencyclopediasource codecfrontiersonycococpcibmgbatosps2game gearpocketpcbasicedgec16metal gearmarcel de kogelunderdogsunixtoshiya takedacopierscolecovisionbugssupervisiontaitochip8faqsfpgatandyrisc oscps2introductionandroidspectravideocasiogrim fandangospace questflashdemo scenevba3dopasopiaoricadventure gameinterpretersnewslettersscorpionatari 7800quasi88apple 1sharpebayolafnesnewsstudio 2bbc basiccomputerscomputersnkz80vaxcamputers lynxascii artstoryrainbowpodcastresources.nethandheldibm pcexcerptadventure gamesacademicfreebsdinfonesarticlesgbcatari800fm townscp/mgallerypsxpc-fxcalculatorteosinclairdownloadstrailblazerfolkloregizmondotype-ingenesis plusjupiter acelisax68000pc-6000sunosmamebasicnesassemblergamebasetoolchaincompetitionmtxp2000computingscummvmzopharmodsvideospainendingsarticledatasheets6502enginegremlinabc80bookaquariusc64dottpdfflyersmonkey islandmz-800colemrom hackfmsxmuseumconvertermusicmapsbluemsxtgemumagazinemacfinal fantasycreativisionquotesspritesflashcartsinterviewsxm7sdlcensorshiparcadetutorialprogrammingepsonsnatcherpentagondma designjrpgbeoscoversx86usenetuaemoviesuae4allgermanycreatorsfusediskmagsddjbo zimmermanneckim-1gamesngpwonderswanuskegsbox shotsscreenshotspluginmac osonlinetranslationsstellascott adamsto8luxorosxmastergearhugues johnsondnahptoolchronologyngpcvcswikipediagithubdelphiunreleasedpcsxdragonpsfsharewarebenj edwardsincompleterom listingspc-98namcoapple 2gsmp3shmupcolumnsnesdingoojaguartutorialssoftwareultimaapogeesoundtracksemulatortvfrancemulemultifacegermancivilizationdownloadsonicsovietzx81thalionifarnoldpatchesron gilbertvideo gamesosf/1mega manmanualhi-scoresacornzx spectrumdatabasenewsletterreferencesmsopen sourcepv-1000emulationngcdcommander keensms plussnes9xsg-1000booksmark3debuggerhexencommodoremagnetic scrollshardwarefpsebabyaixseriesclonesmaking ofnet yarozeralph baerphotosvectrexhintsmz-80timelinegeneratorfeaturegame boybioswalkthroughjapanlinuxfaqftppandorati-92ff7xboxmo5lucasartscharactersllamasoftnsfinstallersqnxwolfenstein 3dfanzinecodeadsunmaintaineditzorkaltairmike daillyarcadiasolutionsgraphicsonline playsega cdvisual basicwinuaeclubatomn64shmupspalmosreplicasfrodoscizx80virtual boyhumorto7i18nmega driveopenglti-99/4asimcoupearchimedessmallmagazinesnvggp2xkigbwikiarstechnicaemulatorsfamtasiastreamingpublishergradiuspasswordsduke nukemti-89odyssey2analysispsionmaniac mansionwiigccdreamcastyoutubethomboulder dashwindows cefrenchtriviapc-88ik+jswsmartphoneforumsfcagiromsitalyremakeappleimagesvic-20ukbbcpiratesgp32hucintellivisionschematicspointlesssaturnspecsfirmwaremz-700videosneo4allasciiartjeff minterpowerpcinterviewmerchandisecompilerdemowscgnuboymsxatarigifrzxcommercialxgscomposersadamms-dosblogcompilationsshopdavid foxjum52ideatari 8-bitpom1darcnespokesx1pc98preservationmastertronicrichard bannistertnkfdstoshibapaul robsonmupenrpgsmipsatari stehead over heelsstrategysidlost sourcearchivednintendomaemosolaris65816cheatspinoutsgiana sisterscopy protectionartworkmasterwizfan fictionphilips68kamigagamerom hackingjavapcwfan arthandyxzxfinal burnid softwarecaanoovgbrpgmarat fayzullinz-codebeebtrs-80charles macdonaldsc-3000consolessoundscansauctionstoolsamstradoperating systemsf-700032xfellowatari stsdkioscd32pc engineguidecollectionpspddrformatsdtvneopocottconverterscompatibilityhitchhikersgbbiographyjapanesesegaplayershomepagegamasutraatari 5200cpudumpingnestergame designmesscomicstcp/ipqlsquaresoftconversionguidesmanualsc128mailing listlibraryretrodevvice8-bitelectronremakesssemwinampcastawayndsdemospeoplejrpgs3d realmshereticcartridgesdoomcartridgedosboxrottversionscd-imediaindiana jonesnetworkingarchivegeocitiesastrocadelynxharvestinfocomjumpmanneopopmagickitrecompilersam coupĂ©reviewsmo6mac plusgpl