emulator

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
link thumbnail Pfau Zeh, *the* Commodore VIC-20 emulator
Commodore VIC-20 emulator for Windows and Linux.
Pfau Zeh is a Commodore VIC-20 emulator and is available for two different operations systems:
  • Pfau Zeh for Win32 is for Microsoft Windows 95/98 and Windows 2000. It requires the DirectDraw and DirectSound parts of DirectX 6.1 (or later).
  • Pfau Zeh for Linux is for the Linux-ELF OS on the X86 platform. It uses the ...
(Added 2003-11-12, 393 hits, more)
link thumbnail PhMAME
PhMAME is a Photon-native port of MAME (The Multi-Arcade Machine Emulator). With PhMAME you can run any of the over 3000 arcade games MAME supports.
(Added 2007-01-18, 385 hits, more)
link thumbnail Phoinix
Phoinix is the name of a Nintendo GameboyTM emulator for the Palm Computing® Platform. It was formerly known as PalmBoy [...], but Palm Inc. claims the word "Palm" as a trademark.
(Added 2007-08-17, 350 hits, more)
link thumbnail PicoDrive
Sega Mega Drive emulator for several ARM-based handheld platforms; can also be compiled to run on Linux.
This is yet another Megadrive / Genesis / Sega CD / Mega CD emulator, which was written having ARM-based handheld devices in mind (such as PDAs, smartphones and handheld consoles like GP2X of course). The critical parts (renderer, 68K and Z80 cpu interpreters) and some other random ...
(Added 2008-04-03, 544 hits, more)
link thumbnail PJO
ABC80 Emulator as a Java applet.
(Added 2003-11-12, 407 hits, more)
link thumbnail PK201 ja translate
Sony PocketStation technical documentation and emulator for Windows.
(Added 2008-06-15, 339 hits, more)
link thumbnail PlasticNES
Version of NextFCE for DOS with some bugs fixed.
[Entry points to the emulator archive at Zophar's Domain.]
(Added 2006-11-24, 367 hits, more)
link thumbnail plus4emu
plus4emu is an open source, portable emulator of the Commodore 264 family of computers (C16, C116, and Plus/4), written in C++, and supporting Windows and POSIX platforms (32 bit Windows, 32 and 64 bit Linux, and MacOS X have been tested). It implements accurate, high quality hardware emulation, however, the system requirements are higher than that of most other emulators.
(Added 2007-05-25, 252 hits, more)
link thumbnail PLynx
Port of Atari Lynx emulator "Handy" to the PSP. Source code supposedly available, but I cannot actually find it.
(Added 2006-02-24, 369 hits, more)
link thumbnail PocketClive
Spectrum emulator for PocketPC handhelds.
PocketClive is an adaptation of the Unix ZX Spectrum emulator FUSE for PocketPC.
[...]
  • Supports 48k, 128k, Plus2 and Plus3
  • Supports both beeper and AY sound
  • Load snapshots in .z80 and .sna format
  • Save snapshots in .z80 format
  • Quickload tape files in .tap form ...
(Added 2006-08-17, 375 hits, more)
link thumbnail PocketClive for Smartphone 2002
Port of Fuse to Smartphone 2002 mobiles. Source code available.
(Added 2006-08-17, 345 hits, more)
link thumbnail PocketHobbit
Port of open-source C64 emulator Frodo to PocketPC.
(Added 2006-08-17, 656 hits, more)
link thumbnail PocketHobbit for Smartphone
Smartphone 2002 and 2003 port of open-source C64 emulator Frodo. No source code.
(Added 2006-08-17, 270 hits, more)
link thumbnail PocketNES
Well-performing NES emulator for GBA.
PocketNES is a NES emulator for Gameboy Advance. In other words, it lets you play Nintendo 8-bit games on a Gameboy Advance. PocketNES is written by loopy and flubba and started out as an assembler port of loopynes emulator for DOS.
[...]
PocketNES does emulate NES games on the GBA in full speed, as incredible as it sounds. It can ac ...
(Added 2003-11-12, 232 hits, more)
link thumbnail PocketSpeccy ru translate
Sinclair ZX Spectrum/Pentagon emulator with floppy disk emulation for PocketPC. No sound support.
(Added 2006-11-07, 716 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
Search:

Tags

saturnsegamipsmanualssg-1000toolchainfm townsfan gamescoversculturepaul robsonsymbianmartin kortharchivedjeff mintertutorialcompilationsacorngame gearmark3assemblernamcocreativisionfdslucasartslinuxmessmetal gearremakemagnetic scrollsdragonemulatorsolafnesrainbowfan fictionoperating systemplus/4tgemubbc basicmega driveemulatorkonamiclubsmartphonemagickitcastawaymaemosdkagiwalkthroughpowerpcfreebsdj2megeneratorfmsxconverterp2000linksarchimedessmallctoshibai18ntriviaatarithalioncomputermultifaceflyersftpjaguaramstradspecsgermanyremakesabandonwaredarcneszopharwikipediadnapeoplestreamingmusicpodcastdtvwindowsbeeblynxcopiers6502kigbromspinouts3doatari steforumbeososf/1windows cescansonlinebasicnespandoragizmondoscott adamsresourcesunixbbcpreservationpasopiacompressionuae4allpc-6000winuaenewsletterssam coupénecscicharles macdonaldtoolbenj edwardscharacterscolemgp32hugues johnsonn64ti-99/4anewsfujitsuwinampdemostandychronologystrategyhintscps2supervisionsmsarmblogideepsoninterviewnvgadventure gamefrontiertoolsgamegraphicssonicguidespublisherusron gilbertdoomluxormike daillyvaxcolecovisionmamedavid foxmaking ofsinclairsoundrichard bannisterspace invadersibmrom hackingdottvgbyoutubewikiti-92atari800interpreterfm-7bugsz-codeconversionlittle johnradiohardwareshmupsultimacartridgespc98sonyarstechnicatoshiya takedawsccivilizationneopopmega manapple 1capcomhistoryincompletezx spectrumelectronsource codejumpmanindiana jonescommercialcasioqnxmo6excerptibm pccartridgepalmospcsxnintendonsfti-89rpgopenglelitecatalogabc80spritesfinal burnddjusenetapple 2gsgame designguideunderdogsxboxdreamcastgifmz-700giana sistersreference32xbiography8-bitngpfamtasiadiskmagsfirmwareemulationbios3d realmsspectravideoopen sourcevideopdfmonkey islandmanualmediafrenchmz-800creatorsanalysiscomputersstudio 2downloadtosscummgallerychip8mo5italyhandygplboulder dashgame boyendingsmastergearpocketpctcp/ipdocsdownloadsunmaintainedaltairscorpionmacmuseumsdlxm7cpcseriespc enginefinal fantasytype-inandroidjupiter acearnoldgamasutramupenboycott advancegradiussgbmailing listmodsastrocadeadamscummvmthomjrpgatari 8-bitrottx86snatcher65816space questwiigbcphilipsplayersreviewshpddrcolumnspointlessconvertersto7solutionsfrodosms plusatomc64pspmerchandisecomposerspentagonmasterzx80nesmoviesfan artpasswordscp/mjavafusenet yarozeaction replayrick dangeroustaitoarcadiasquaresoftsnkatari 5200qlvideo gamesneo geoxgsjrpgsiosprogrammingjswencyclopediafpcefpgaacademicarcadeosxcollectinggenesis plusms-dospokestrailblazerinfoneskim-1gamecubeintroductionschematicsoricndsbluemsxshmupscreenshotsdebuggerzaurussega cdsierraarticlesdemocamputers lynxvisual basicbo zimmermandescentjapanesecheatsapplepettnkatari 7800uaecollectionc128x68000solarisbard's talepsionretrodevsc-3000storybabyff7apogeecompilerhead over heelsvideosneo4allsimcoupedma designifspainbox shotsinterpretersformatsfeaturevirtual boycpusfcimagesrpgswalkthroughshomepagedosboxfaqcocokegsfranceshopgp2xpectruminterviewsid softwaremapsunreleasedngpcrisc osmulemsxcodehexenmidihi-scorespsxc16hitchhikercopy protectionwizxzxflashbooksaixauctionsgamebasecommander keenralph baertvmaniac mansiongnuboytranslationswonderswangeocitiessunosnetworkingssemmtxneopocottflashcartsdemo scenedelphirecompileruksidwolfenstein 3dtrs-80germanmac oslisaquotesedgeteofellowdatabasemastertronictutorialsfolklorehuchumorquasi88x1jum52piratesgrim fandangogp2xebaydumpingmarcel de kogelpatchesik+pluginsovietamigaclonespc-fxcaanooconsolesarchiveascii artpc-98ngcdjapaninstallersphotosatari sttimelinecompetitionpv-1000lost sourcefaqsfanzinexm6cd32rzx.netremixesps2snes9xadventure gameslibraryzx81rom listingsdingoorom hackfpsez80apple 2hereticharvestcomicsvcsgbacomputingvicecommodoreinfocomto8sf-700068kitllamasoftartworkcd-iintellivisionportreplicasodyssey2magazinetechnotesversionsgremlinzorkfcemz-80mp3psfos/2asciiartbasicsoundtrackscensorshiprom hacksbookonline playvectrexmarat fayzullincalculatorsharpadsgithubduke nukemaquariusiadatasheetsmac plusnewslettergamesnestervbahandheldpcwarticlepc-88vic-20compatibilitysharewaresoftwarepom1stellamagazinesgccengine