emulator

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
link thumbnail lazynes
NES emulator for Windows with network play and limited mapper support.
NES emulator with scanline based rendering, uses DirectX for graphics, supports mappers 0, 2, and 3, and partially supports mapper 1, Sprite rendering, Vertical, Horizontal, and Four Screen Mirroring. It also Supports NetPlay.
[Web site not in Internet Archive due to robots.txt exclusion; entry p ...
(Added 2006-11-22, 417 hits, more)
link thumbnail Lisa Emulator Project
Apple Lisa emulator for Windows, Linux, and Mac OS.
(Added 2007-08-15, 344 hits, more)
link thumbnail LissNES
NES emulator for Windows written in Visual BASIC.
[Downloads have not been archived, and I have been unable to track down the source code. Binary at Zophar's Domain.]
(Added 2006-11-22, 402 hits, more)
link thumbnail Little John PalmOS
An NES, GB/GBC, Super Famicom, Mega Drive, SMS, Game Gear, Neo Geo Pocket, Wonderswan, and Atari 2600 emulator for ARM-based PalmOS devices based on a number of single-system emulators.
(Added 2006-11-16, 559 hits, more)
link thumbnail Little John Z
Zodiac port of multi-system emulator Little John. Source code available.
(Added 2007-01-12, 236 hits, more)
link thumbnail LJGP32
GP32 port of NES emulator Little John.
(Added 2006-11-21, 316 hits, more)
link thumbnail Loopynes
NES emulator for Windows.
It's a Nintendo emulator for MS-DOS. Mappers 1,2,3,4,7,9,11,15,16,21,25, 34,64,71,76,99,151 are supported. You probably need a SoundBlaster16 or better to hear anything.
The description at Zophar's Domain is a bit more telling:
oopynes supports an good number of mappers, some ...
(Added 2006-11-22, 229 hits, more)
link thumbnail Luxor ABC80 emulators
Luxor ABC80 emulators for DOS, Unix/X11, Amiga, and Windows.
(Added 2006-08-24, 386 hits, more)
link thumbnail M2000
Philips P2000 emulator for DOS, Linux/SVGAlib, and Unix/X11. Source code available.
(Added 2006-08-31, 349 hits, more)
link thumbnail MacBaby
Emulation of Manchester University's Baby for Mac OS Classic.
(Added 2006-08-17, 333 hits, more)
link thumbnail MacUAE
Port of Amiga emulator UAE to Mac OS Classic.
[Downloads have been archived.]
(Added 2006-08-17, 369 hits, more)
link thumbnail MacVICE (Lallafa’s Blog)
This page is the central place for information about the development of MacVICE, the official port of the VICE emulators.
(Added 2012-10-08, 238 hits, more)
link thumbnail MadNES
Incomplete NES emulator for DOS.
MadNES supports a decent number of mappers, but has primitive sound support. It also has preliminary lightgun support and joystick support. It's about average.
[Web site not in Internet Archive due to robots.txt exclusion; entry points to emulator archive at Zophar's Domain.]
(Added 2006-11-22, 277 hits, more)
link thumbnail MadNES, ARCNes (Acorn NES Emulators Homepage)
MadNES:
This is a port of Roberto Rosario's NES emulator, it is quite nice and is very accurate. It is being developed readily and thus should be a nice addition to the Acorn emulation scene! This emulator thus replaces ARCNes!
[...]
ARCNes:
You can still doownload this emulator, which will no longer be developed!
(Added 2012-10-08, 122 hits, more)
link thumbnail Magic Engine enfr
Shareware PC Engine emulator for Windows and Mac OS.
(Added 2003-11-12, 300 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
Search:

Tags

mo5atari800n64patchescollectingshmupshexencharles macdonaldgbatoolwizpowerpcnesz80bbc basicmarcel de kogelgp2xfm townsjaguarpc-6000rpgcivilizationscreenshotsfaqmupeninfonesspainrpgsguidelinuxneo geoultimati-92multifacemaemoonlinesmspsffcepasswordsgenesis plusbluemsxyoutubedownloadsmo6sunosfirmwareamstradkegspspmagazinesmediafmsxmagazineatari 7800philipsacademicedgestudio 2dma designqlbookrzxstrategyremakecd-iopen sourcemz-700jum52boycott advancebabypc-98referenceluxorpv-1000fan fictionexcerptapple 2c128hereticdocsblogiaxboxgplcompetitionastrocadeadamflashspace questoricunmaintainedinterviewdownloadhi-scoresgifdatasheetssegacolemcps2galleryadventure gameremixespluginmaking oflittle johnpasopiagp2xpectrumapple 1specsc16arcadiamike daillyfusenintendotriviavisual basicsonyencyclopediaartworkmanualscpuhumorflyersftptgemuindiana jonesbiosmark3lisacocodatabasewinampmodspeoplelynxneopocottstreamingcp/mteox86famtasiapom1snatcherbox shotsquotesto7olafnesfellowcommander keenhead over heelscpcsharewarezx81emulatorscodearticlesgradiusjapanesendstcp/ipnamcoid softwareportarticlegermanyvgbc64openglmartin korthpinoutssolarisbooksfan artgraphicsaixsovietemulationpreservation32xmerchandisearchiveddemosscansvectrexpsionsimcouperichard bannistercomposersibmfm-7ccommercialpc-fxboulder dashzorkplus/4museumcartridgezaurusstorycamputers lynxtype-inti-89scorpiontoolchainddjms-doscapcomtutorialgizmondofolklorejavaebayscifrontierhomepagecd32windowsmaniac mansionqnxfreebsdngpthomanalysisdoomkonamidottpublisherspace invaderssam coupéos/2uaerom hackingamigamameasciiartplayerscensorshipxm6calculatorduke nukemuae4allsaturni18nwiiron gilbertodyssey2walkthrough.netiosunderdogsbard's talewalkthroughssoundengineintellivisiongamebasecolumnsvideodiskmagsvbajrpgcompressiondelphispritesacornzx80programmingnewsunreleasedtosabandonwarehardwarebeebmastertronicxgscaanoo3dopaul robsonarnoldatari stjupiter acewscdemocasioromssupervisionsc-3000ngpcnewsletterjrpgssfcdemo sceneinterpreterfinal fantasycomputer3d realmsconsolesandroidunixto8ssemhandyvideosintroductionmacdtvarchivesource codezophareliteadventure gamespiratesauctionsinterpretersgamesidmidibugsvideo gamesthalionnecatari stegameswindows cedarcnesgamecubefinal burntaitovic-20winuaecreatorssolutionsx68000net yarozeconvertertoshiya takedajeff minterrom hackssega cdngcdatari 8-bitadssoundtracksmp3recompilerzx spectrumfujitsubiographyretrodevsierragiana sistersdescentchronologyfrodopokesrom hackhprottresourcestvharvestascii artstellaaltaircatalogvaxapogeemtxshopsonictrs-80hintsgccpandorafpgarom listingsgame geardebuggerpalmossymbianti-99/4aaquariusatomnestergithubvirtual boyscummmapsdragongermanidepdfoperating systemclubsnes9xxzxneopoptoshibamega drivedavid foxquasi88ralph baerbbcps268krick dangerousgeocitiesgnuboyp2000mailing listinstallersibm pcmipssms pluskim-1wikipediacompilationselectroncomputersgame designcartridgesformatssinclairik+arcadefanzinecopiershistorycompilerabc80nvghucmanualjswsoftwaresgbshmupz-codeapple 2gssg-1000marat fayzullinchip8featureschematicssmartphonegremlinmessreplicasitwikicreativisionimagesaction replaytechnotesfrenchmastergeneratorpsxclonesbo zimmermanatari 5200pcsxmoviesmagnetic scrollssdlassemblerphotosmz-800gp32pc-88commodoremac ososf/1beosnetworkingarstechnicamulearmjumpmantutorialsdingooifflashcartssmallcompatibilitydosboxnewslettersinfocomculturellamasoftx1scummvmspectravideopcwcastawaylucasartsvicefpseff7forumatarilibrarypointlesstoolscopy protectionconverterspentagonfpce65816tnkemulatorbasicscott adamsusenetonline playpocketpcconversion8-bitsnkosxsharpgrim fandangocomicsdumpingwonderswansf-7000rainbowvcsddrmac plusj2mearchimedeslinksreviewstimelinesquaresoftjapanmz-80handheldkigbbasicnesgame boycollectionfan gamesmastergearcharactersfdstandygamasutragbchitchhikercolecovisionguidesendingsremakesmagickit6502lost sourcerisc osmusictrailblazerpc enginecheatspodcastseriespetinterviewssdkusmsxepsonmetal geardnahugues johnsonversionsbenj edwardscomputingxm7neo4allradiomega manwolfenstein 3ditalymonkey islanddreamcastagipc98nsffranceincompletefaqstranslationsukapplecovers