emulator

<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
link thumbnail EmuZ-2500 enja
Sharp MZ-2500 emulator for Windows.
(Added 2007-06-04, 443 hits, more)
link thumbnail EmuZ-2800 enja
Sharp MZ-2800 emulator for Windows.
(Added 2007-09-03, 543 hits, more)
link thumbnail EmuZWin
ZX Spectrum, 128, +2, +2A, +3, Pentagon, and Scorpion emulator for Windows. Supports SPEC256 256-color games.
(Added 2006-08-17, 422 hits, more)
link thumbnail ep128emu
Portable Enterprise 128 emulator.
(Added 2005-12-17, 345 hits, more)
link thumbnail ePSXe
PlayStation emulator for Linux/x86, Windows, and Android.
(Added 2003-11-12, 471 hits, more)
link thumbnail ePV-1000 enja
Open-source Casio PV-1000 emulator for Windows.
(Added 2007-06-05, 759 hits, more)
link thumbnail eQC-10 enja
Epson QC-10/QX-10 emulator for Windows.
(Added 2007-06-05, 422 hits, more)
link thumbnail Ergon's ZX Spectrum emulators Web page
Home of Spectrum 48k/128k emulators Zexcel, ZM/128, and ZM/hT for Sinclair QL.
(Added 2006-08-17, 425 hits, more)
link thumbnail eRX-78 enja
Bandai Gundam RX-78 emulator for Windows.
(Added 2007-06-08, 317 hits, more)
link thumbnail ES40
Portable open-source AlphaServer ES40 emulator.
(Added 2008-03-19, 258 hits, more)
link thumbnail EX68 ja translate
Sharp X68000 emulator for Windows.
(Added 2003-11-12, 759 hits, more)
link thumbnail Executor (ARDI)
Home of of Macintosh/68k emulator Executor and 68k emulator Syn68k, running under Windows and Linux. Both have been open-sourced in 2008 and since ported to Mac OS X.
We were the only company to create Macintosh emulation software that allows Macintosh programs to run on non-Macintoshes without using Apple's Intellectual Property. However, our technology is ridiculously out-dated an ...
(Added 2006-07-06, 480 hits, more)
link thumbnail FakeNES GT
FakeNES is a highly portable, Open Source NES and Famicom emulator.

It runs on all modern operating systems (such as Windows, Linux, and Mac) and has an actively maintained DOS port for enthusiasts. Support for phones and other mobile platforms is under development.

Originally created in 2001 by a rag-tag team of developers from projects such as ZSNES, after t ...
(Added 2006-02-24, 305 hits, more)
link thumbnail Famtasia ja translate
NES emulator for Windows with lightgun and FAM ROM image support. From Zophar's Domain:
Famtasia, previously called Famicom, is written by taka2 and nori. It supports the .nes, .fds, and a less common .fam ROM format.

It runs several games and has fair sound support. It also includes configurable support for non standard controllers, such as the light gun. Overall its pre ...
(Added 2006-11-17, 633 hits, more)
link thumbnail Famtasia 5.1 Patch Vending Machine
Download a version of NES emulator Famtasia 5.1 with a custom set of patches applied.
(Added 2006-11-17, 409 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 >   Next Page >>
Search:

Tags

cpupc-88soviet.nethitchhikerx68000gccllamasoftarcadiapsxrainbowuksam coupĂ©bbcedgegififmanualspectravideooperating systemarchimedesquotesdownloadsastrocadeopen sourcezx80descentcastawaysms plusepsonmastern64z-codeadsj2mecreatorsstudio 2dottx1reviewsrom listingsmetal gearlibrarytrailblazercocomerchandisearmarchivemarat fayzullinti-92neopopmac oscivilizationnetworkingqnxteocommander keentandyiaddrmagickitnecwalkthroughoricgraphicsclonesxboxkigbfujitsuvbaclubcompressionadventure gameps2programmingguidesmo5jum52fpseatari stpsionhandhelddragonxm7calculatortososf/1video gamessoftwaretrs-80gamesmsxdtvchip8asciiartmo6xm6tnkfolkloregbclinksspainnvgencyclopediacolemfellow65816online playfan gamesfm-7nestoolchainpentagonvideosyoutubeatariolafneshereticsegasharppatchesmastertroniccoversdocslittle johnopengldiskmagskegsgamecubeluxorlynxtriviawizcompilationsmagazinessmscomicsjapanfreebsdintellivisionos/2toolhparstechnicaquasi88faqwikifamtasiagamasutrawikipediaplayerssolutionsmtxfan artapogeemupenharvestcp/musenetwscneo4allfrenchcollectionnsfpasswordsgremlinjumpmanabc80mamemartin korthcomposersscott adamssaturnatomremakescensorshipdnaassemblerc128gizmondorpggamebasefrancetutorialsms-dosinterviewbiographyneopocottscansscorpiongnuboywinampsfcgrim fandangoodyssey2apple 1magnetic scrollsincompleterottplus/46502namcosnatcherspace questsonyconsolessdlshmupspv-1000installersmp3videotoshiya takedapcwhandygplgermanwalkthroughsitalyrecompilersharewarevaxpiratesfaqsfeaturedemossolarisduke nukemmega drivepreservationdingoojswaltairsunosseriesstellasiddarcnessg-1000datasheetsdumpingtoolsaction replaychronologyatari800lucasartsfirmwarexzxpc-6000thalionadventure gamespsfgamepinoutssonicblogreplicasinfonesjrpgsbbc basicuae4allmark3emulatorsmacsega cdmike daillycharactersjrpgcpccopiersatari 5200onlinendsmediastorycollectinghumorarticlesdelphidavid fox32xpublishertoshibaconvertersrom hackskonami3doarcadeacorngradiusxgsik+arnoldsupervisiontcp/ipacademicscummvmgp32kim-1newstranslationsc64basiccreativisionwonderswansoundremakepc-fxpodcastrisc osphilipstechnotesanalysisvic-20atari 8-bitrick dangerousaquariusapple 2zopharultimafinal burnshopbeebcaanooflashcartscompetitiondemo sceneagipocketpcgallerytimelinefdssinclaircd-ingpcbooksc-3000introductiondemoradiocamputers lynxwiihomepagecharles macdonaldibm pcpalmoscolumnsmarcel de kogelretrodevcartridgescatalogsgbdatabaseformatsresourceslisaascii artversionshi-scoresmailing listsierramapsmaking ofpc-98smartphonepointlessgame designpdfwindows cecomputerbabymusicelectronmuseumwindowstaitosmallnewsletterpc enginei18nnesterfpgajapanesescreenshotssimcoupeconversionsquaresoftvgbgermanymonkey islandvectrexartworkinterviewsto7zx spectrumthommac pluscd32soundtrackscartridgeexcerptgeneratormessz80amigaemulationcolecovisioncompatibilityreferenceconverterbasicneswinuaemipssf-7000final fantasycomputingngcdromswolfenstein 3dvicesnes9xtvgame gearsource codeforumgeocitiespaul robsonamstradunderdogsmz-700boulder dashcomputerspasopiainfocomfrodo8-bit3d realmsenginebard's talehardwarespritesphotospandoracheatscodemanualselitepom1mega manatari 7800rzxcftpdownloadendingsdreamcastcasiofanzineto8richard bannisterron gilbertspace invadersunmaintainedngpsymbiancommodoredoomp2000genesis plusideadamgithublost sourceemulatorzorkibmralph baerbiosdma designpcsxfan fictionnewslettersbenj edwardsguideplugintgemubeosinterpreterauctionsunreleasedabandonwarebugsremixespokesc16virtual boyti-89booksculturecommercialscijavaatari stehugues johnsonlinuxsdkarchivednet yarozemz-800powerpcsnkbox shotsmaemocompilerddjgp2xti-99/4aandroidgiana sistersspecsvcshucdosboxcps2peoplearticledebuggermz-80modsstreamingportjaguarapple 2gsscummappleid softwareituaeshmupfpceff7historyssemfm townscapcomtype-inzaurusflashgbarom hackpc98qlmuleschematicscopy protectionhexenpspstrategyfrontierrpgsiosusfmsxgp2xpectrummidi68kbo zimmermanbluemsxneo geonintendotutorialmaniac mansionaixjeff minterzx81fcegame boyfusemovieshead over heelsjupiter acehintsebayboycott advanceindiana jonesmagazinemultifaceflyersmastergearunixinterpretersrom hackingimagesosxx86petvisual basic