
1 2 >   Next Page >>
link thumbnail Hu-Go cool enfr
PC Engine emulator derived from FPCE, and available for Linux, Windows, DOS, BeOS, Morphos, and Solaris.
(Added 2003-11-12, 1084 hits, more)
link thumbnail ScummVM cool

ScummVM is a program which allows you to run certain classic graphical point-and-click adventure games, provided you already have their data files. The clever part about this: ScummVM just replaces the executables shipped with the games, allowing you to play them on systems for which they were never designed!

ScummVM supports many adventure games, including LucasArts SCUMM g ...

(Added 2003-11-12, 719 hits, more)
link thumbnail VICE Emulator, The cool
VICE is a program that runs on a Unix, MS-DOS, Win32, OS/2, Acorn RISC OS, BeOS, QNX 4.x, QNX 6.x, Amiga, GP2X, Dingoo, Syllable or Mac OS X machine and executes programs intended for the old 8-bit computers. The current version emulates the C64, the C64DTV, the C128, the VIC20, almost all PET models, the PLUS4 and the CBM-II (aka C610).
(Added 2003-11-12, 773 hits, more)
link thumbnail VisualBoyAdvance cool
(Still?) the best choice for both play and development.
VBA is the best and most popular Gameboy Advance emulator around. Emulates GBA, GBC, SGB, GBA roms! Supports ZIP-ed roms, so that after downloading files from the net you don't even have to un-zip them.
(Added 2003-11-12, 533 hits, more)
link thumbnail

SDL Asylum is a C port of the computer game Asylum, which was written by Andy Southgate in 1994 for the Acorn Archimedes and is now public domain. It should be possible to run it on any platform which support SDL and OpenGL graphics. It's developed primarily on Linux but has also been built successfully on Cygwin, FreeBSD, Windows and Haiku.

SDL Asylum is currently li ...

(Added 2007-09-10, 756 hits, more)
link thumbnail BeBeeb
BeOS port of BBC Micro emulator xbeeb. Only the source code has been archived.
(Added 2006-08-17, 474 hits, more)
link thumbnail Beccy
Spectrum emulator for BeOS.
This is just a development preview release of ZX Spectrum Emulator. Development Preview release of Beccy is really resource consuming program. It contain a lot of code which needs optimization. Both Z80 virtual processor code and ZX Spectrum virtual machine may contain some bugs. I would appreciate any informative bug reports.
(Added 2006-08-07, 545 hits, more)
link thumbnail BeebEm for BeOS
BeOS port of BBC BeebEm.
(Added 2006-08-17, 498 hits, more)
link thumbnail BeS9x
BeOS port of Super Famicom emulator Snes9x.
[Source code and a more recent binary can be found at BeEmulated.]
(Added 2006-08-30, 553 hits, more)
link thumbnail BeZX
Sinclair ZX Spectrum emulator for BeOS (x86 and PowerPC), based on XZX.
(Added 2006-08-08, 687 hits, more)
link thumbnail Circus Linux!
A "Circus Atari" clone; despite the name, it is available for numerous platforms and hot on the heels of xrick for the title of "most ported game ever".
(Added 2006-02-10, 695 hits, more)
link thumbnail CloneKeen
Almost complete clone of Commander Keen: Invasion of the Vorticons by ID Games.
In addition to emulating the gameplay of the original Commander Keen games, CloneKeen has some extra features which weren't present in the original game. You can play with 2 people, there is a built-in level editor for creating and sharing your own user maps, and there are some for-fun options such as Full ...
(Added 2006-02-10, 632 hits, more)
link thumbnail Frodo
The free portable C64 emulator. C64 emulator for Linux/Unix, BeOS, and AmigaOS, with ports available for many other platforms.
(Added 2003-11-12, 656 hits, more)
link thumbnail Hatari
Hatari is an Atari ST and STE emulator for GNU/Linux, BSD, BeOS, Mac OS X and other systems that are supported by the SDL library. The Atari ST was a 16/32 bit computer system which was first released by Atari in 1985. Using the Motorola 68000 CPU, it was a very popular computer having quite a lot of CPU power at that time. Unlike many other Atari ST emulators which try to give you a g ...
(Added 2003-11-12, 504 hits, more)
link thumbnail Head over Heels PC
Very good-looking remake for BeOS, Win32, OSX, and Linux.
(Added 2006-02-10, 471 hits, more)
1 2 >   Next Page >>


capcomscummvmdiskmagsfpcetvunmaintainedfaqssonytrailblazersharewareguidemamesource codepiratesnsfnamcoporttoshiya takedafan artdescentemulators6502electroncomputersrainbowenginetype-inremakesplayersvaxscott adamsneopocottgradiuswikipediatutorialhandheldgalleryinstallersunreleasedcollectionmanualsbeebarnoldhugues johnsondemo scenedottmac osc16uaeadventure gamescatalogcastawaygplgremlinforumjeff minternecmz-80recompilerrom hackscodecommodorescorpioncreatorsseriesfreebsdaquarius3doityoutubeodyssey2head over heelspc-fxbeosdtvphilipsretrodevapogeesidcommander keensunosgp32os/2chronologygame boyatari 7800jswatari 8-bitps2apple 1konamibookssquaresoftmark3atari 5200shopmagazinehitchhikermaemonesz-codeflyerscd32technotescp/mmartin korthgamasutrakim-1heretictimelinegamebaseremakefdsviceindiana jonesndsgamesierrahumorarmgame designmacfinal burnsdkn64wolfenstein 3dmultifacepasopiabluemsxpentagondatasheetsgamecubegp2xunixascii artpublisherauctionssc-3000rottmaniac mansionftpralph baerfrontierrick dangerouscartridgepc-88making ofradioatari stngcdqlmuledragonqnxpluginbbcrpgsacornzopharxm6aixj2megameseliteti-92archiveteopowerpcmupencpconlinenewslettersfaqromspandoraclonescps2mike daillysolarisincompletemerchandisexzxamigaremixesrisc osfirmwareconvertersimagesc128applerpgrzxpatchesioswiivirtual boyinterpretersstellagiffm-7smallcomicspinoutspv-1000shmupsx1academicdoomcommercialspecsmac plusconversionresourcesrom hacktosfrodopeopledownloadcharactersadventure gameusenetssemlinksnet yarozeid softwaretrs-80wikisharpmz-800strategymastertronicp2000converterlucasartsngpmastermagickitjapaneseassemblerscanscasiofan fictionfujitsusnes9xmega mandarcnesmetal gearfolklorenesterolafnesjrpgsngpcvcszx spectrumneo geotrivialynxemulatorsonicgraphicspdfreplicasbox shotsussaturncivilizationmastergearsf-7000walkthroughsega cdc64dingoopom1pcwatari800historyasciiartwindowsgeneratorepsonlisacolecovisionmediatoolmuseumplus/4toshibagbafcearstechnicaoperating systemcolemculturecopy protectionnewszaurusencyclopediasoundtracksmp3abc80mz-700frencharcadejaguarpodcastlinuxastrocadewizebayspritescopierssmsbookscreenshotspasswordsfamtasiaitalyxm7agicamputers lynxmipsti-89messneo4alldemoflashcartslibrarysam coupĂ©charles macdonaldboulder dashversionsarchimedescomposersmo6fusesupervisionsolutionssoundstreamingnetworking65816calculatorfmsxdumpingneopopjrpgmarcel de kogelcoversreviewsadamsfccollectinggiana sistersopenglunderdogsvideosrom hackingdma design.netduke nukemcolumnsinterpretergp2xpectrumhporichandysinclairpointlessadsdocswonderswanamstradinfocommodsendingsonline playmapsquotesddrfpseidehintscompetitioniatgemuik+clubandroidexcerptaction replaycartridgesms-dospreservationdreamcastti-99/4aarticle3d realmshardwarexboxto7rom listingspokessnatchertoolsedgewindows ceff7msxschematicsinterviewmagnetic scrollsmonkey islandsnkx86apple 2gsmailing listdavid foxibm pcinfonesjavapspwinampreferenceabandonwaremidiconsolesdosboxvgbjupiter acez80softwarecompressiongbcnvgprogramminghi-scores68ktandybenj edwardsspectravideojum52pc98petjumpmanflashlittle johnpsionchip8fm townsgrim fandangollamasoftfan gameszx80computinghomepagecaanooguidessms plusron gilbertbbc basicdatabasetnkartworkintellivisionx68000tcp/ipatari stefpgawalkthroughssovietsymbianultimafeaturegccspainarcadiagnuboydelphipsxosf/1apple 2sg-1000cpucomputercd-iataripsfpcsxddjscummtaitobiosgame gearpc-98visual basicaltairopen sourcewscarticlescukmagazinesquasi88mega drivebard's talesegaspace questthomcompilationsvideodebuggergeocitiesxgsdnabugsnewsletterzorknintendophotosmarat fayzullinosxfellowtutorialsbiographyuae4allzx81palmoscreativisionsimcoupedownloadsboycott advancevbashmupinterviewscocojapanwinuaesgbpaul robson32xthalionstoryvideo gamesibmemulationpocketpcarchivedgithubbasicnesmoviesmanualkegsto8german8-bitgermanycompatibilitysmartphonefinal fantasyluxorformatscheatsvic-20introductionanalysisgenesis plusharvestrichard bannistersdlatomtoolchainmtxscibloglost sourcekigbpc-6000pc enginefanzinemo5hucvectrexhexencompilergizmondocensorshipstudio 2translationsbo zimmermanifspace invadersmusici18nfrancebabybasicdemos