articles

1 2 3 4 5 6 7 8 >   Next Page >>
link thumbnail Armchair Arcade cool
Dedicated to intelligent coverage and discussion of classic and modern videogame and computer topics. Features commentary on current events, articles, features, games and a plethora of other content.
(Added 2007-01-06, 836 hits, more)
link thumbnail GameTronik cool fr translate
Great video game archive featuring complete sets for many vintage computer and video game consoles, including some CD-based systems. Fast downloads. Also has gameplay videos, articles, French TV clips, a comic, and more.
(Added 2008-04-15, 1405 hits, more)
link thumbnail Interactive Fiction Archive, The cool
All the interactive fiction-related stuff you can download: Artwork, articles, books, tools, games, interpreters, magazines, programming, solutions, and more.
(Added 2003-11-12, 732 hits, more)
link thumbnail Consolemul hot fr translate
Toute l'émulation console. News, articles, forum, emulators, (PD) ROMs, utilities, and French ROM translations.
(Added 2003-11-12, 1592 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 549 hits, more)
link thumbnail Acorn Elite Pages, The
The Archimedes version of Elite is widely regarded by experts (and myself) as the best installment of the classic game. This site features hints and tips, troubleshooting help, pictures, info on the Thargoids, many, many downloads, magazine articles and interviews, fan fiction, and links to related sites.
(Added 2003-11-12, 518 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 507 hits, more)
link thumbnail Adventure Classic Gaming
Dedicated to classic and retro adventure gaming. Reviews, exclusive interviews of developers and publishers, features on adventure gaming, and game cheats.
(Added 2006-09-24, 467 hits, more)
link thumbnail Amstrad CPC Hardware page
A few projects for the Amstrad CPC range of computers along with some techie articles out of English CPC mags.
(Added 2008-04-13, 370 hits, more)
link thumbnail Amstrad ESP es translate
almost complete catalog of Spanish games for the CPC, with screenshots and downloads, articles about Spanish software houses, cheats, and a forum; registration required!
(Added 2006-02-24, 900 hits, more)
link thumbnail Articles on the History of Computing
Numerous articles on the history of computing and software engineering by Michael S. Mahoney, Professor of History at Princeton University.
(Added 2008-06-15, 324 hits, more)
link thumbnail Atari Bin, The
Atari timeline, Lynx and Jaguar FAQs and reviews, many articles.
(Added 2006-08-29, 522 hits, more)
link thumbnail Atari Times, The
Game reviews for all Atari systems, articles, columns, interviews, chat, forums, hi-scores, and more.
(Added 2006-09-14, 500 hits, more)
link thumbnail atari.area pl translate
Atari scene site. News, articles, forum, wiki, interviews, software database.
(Added 2006-09-03, 1021 hits, more)
link thumbnail Black Moon Project, The
We aim to become the premier resource for Philips CD-i related material. Including Reviews, Movies, Articles, Interviews, Boxart, Manual Scans and anything else that could possibly be related to the CD-i.
(Added 2007-01-07, 565 hits, more)
1 2 3 4 5 6 7 8 >   Next Page >>
Search:

Tags

konamips2atari 8-bitflyersunreleasedscipandorayoutuberpgs32xjumpmansoundtracksatari 5200sf-7000zopharzorkdragonjeff minterfpcefdshereticjum52pentagonreplicasremakesduke nukemmarat fayzullinusenetcollectionpc-6000graphicspsionhugues johnsonnsffanzinezauruschronologyeliteauctionstriviagamems-dosron gilbertbbcgame boyspecsapple 2gsdarcnessierradocsasciiartartworkmamexzxconverterhintsfpseremakefreebsdsquaresofttcp/ipbluemsxthomemulatorgamasutralisazx80dnamulegeocitiessg-1000resourcestranslationsplus/4retrodevmapswindows cemultifacepowerpcmastermarcel de kogeloperating systemmoviesqlvic-20arm65816interpretersmac osrom hackingssemarcadiadreamcastconversionpaul robsoncommander keenrecompilerrottsms plussdkpv-1000sdlwiiapple 2usphilipsimagesioscd32dtvatari800biosmacstorybookpublishergccacademicsovietc128cps2colemnewslettersgifsnes9xarticlescummvmcreatorsnet yarozeadventure gamegamebasehumordownloadsdelphiddrblogmz-80neopocotttaitomuseumarstechnicavcsmesscreativisionnestertoolchainos/2arnoldsymbianboycott advanceonlineneo geowinampcoversukmo5sunosmp3fan gamesmtxengineinterpreterpreservationreferenceonline playosxmupenmz-700open sourceitalyfusestellaspritesspace questsupervisionluxorsimcoupegbato7fcejaguarcharactersxgsjavalittle johninterviewhomepagebugshardwaretimelinemanualcartridgesatari steopenglpluginbasicdemocataloguae4allmaniac mansionformatsadamnewspodcastitwalkthroughsfrontierscummcommercialiap2000sinclairebaygame designlucasartsspectravideotoshibatype-inmartin korthpasopiasegaradiothalionj2mepetsolarisflashcartsrzxincompleteaquariusdingoo8-bithi-scoressoundcompressiontoshiya takedacharles macdonaldintellivisionjupiter acepointlessquotescocomodshpfamtasianewsletterarchivekim-1teogenesis pluscasiotandycomputerngcdgp2xneo4allepsoncpulost sourcehistoryapogeeatari stmark3programmingjrpgside.netboulder dashmagnetic scrollsculturecivilizationguidecensorshipemulatorsgp32interviewsinfonesto8datasheetsvideosxm6odyssey2kegssc-3000appleclonesz-codewindowscodeuaecomposersshop3d realmshandheldnesfellowibmfm-7miditi-99/4aspace invaderspc-88mac plusgalleryllamasoftvideofeaturecomputinghead over heelsunderdogspsxgeneratorvbametal gearvicepc-98smartphoneascii artdottromsmonkey islanddownloadwolfenstein 3dnetworkingmagickitneopopsource codebeebquasi88apple 1fpgasidcp/mgermanychip8nvgrom listingsx1abc80saturngrim fandangofaqsexcerptlinuxastrocadeacornvaxtgemurpgmike daillygnuboycastawayversionsforumn64palmosvgbmaemopasswordssmallamigasnatchermediasam coupécmagazinestreamingmastertronicmerchandisepeoplefrenchcollectingik+bo zimmermanff7box shotsunixfrodoftpfolklorendssharewaretoolsscott adamsgbcc64remixesarchimedeshandyflash3dodiskmagsstrategynintendovirtual boyfrancemailing listmaking ofwinuaeagidatabasemusicsoftwaregamecubefirmwaredumpinggithubpokesvisual basicwikilibrarysonicz80compilationsbenj edwardstutorialcolecovisionmipsrainbowpatchesngpcsgbtechnotescompilerscreenshotsdemo scenebasicnesbabypocketpcsolutionstrailblazeranalysisseriesschematicstnkguidesrisc osclubaction replaypc98walkthroughcompetitionatomplayerscpcnecabandonwarenamcokigbemulationid softwarebooksassembleramstradsnkti-92linksindiana jonesngpcapcomatarifinal burnmsxcompatibilityphotosstudio 2wikipediareviewswonderswanconsolesgp2xpectrumfmsxhexenelectroncamputers lynxrom hackspcsxadventure gamesjapanesetoolmastergeargplbard's talewscmanualsarcademagazinesgiana sistersibm pcosf/1sega cdbbc basicadsolafneszx81vectrexwizcaanoo68kultimapspportifc16smsarchivedcd-ipinoutsconvertersinfocomx86gamestutorialsmo6copiersarticlesoriccommodorevideo gamesshmupsdma designtosfan fictioncheatsandroidcopy protectionpsffan artspainpom1pcwharvestxm7gradiussfcshmupcomputersedge6502lynxdescentpc-fxencyclopediarichard bannisteraltairralph baerscansjapanfm townsmz-800x68000rick dangeroushucpc enginesharpaixbeosgremlingame gearjrpgjswendingszx spectrumgermanfujitsucalculatorti-89sonyfaqintroductionxboxunmaintainedqnxdemosgizmondopdftrs-80david foxdosboxcartridgerom hackscorpionatari 7800mega driveddjcolumnsinstallersmega mantvcomicsfinal fantasypiratesbiographyhitchhikeri18ndebuggerdoom