articles

1 2 3 4 5 6 7 8 >   Next Page >>
link thumbnail Armchair Arcade cool
Dedicated to intelligent coverage and discussion of classic and modern videogame and computer topics. Features commentary on current events, articles, features, games and a plethora of other content.
(Added 2007-01-06, 1224 hits, more)
link thumbnail GameTronik cool fr translate
Great video game archive featuring complete sets for many vintage computer and video game consoles, including some CD-based systems. Fast downloads. Also has gameplay videos, articles, French TV clips, a comic, and more.
(Added 2008-04-15, 1895 hits, more)
link thumbnail Interactive Fiction Archive, The cool
All the interactive fiction-related stuff you can download: Artwork, articles, books, tools, games, interpreters, magazines, programming, solutions, and more.
(Added 2003-11-12, 916 hits, more)
link thumbnail Consolemul hot fr translate
Toute l'émulation console. News, articles, forum, emulators, (PD) ROMs, utilities, and French ROM translations.
(Added 2003-11-12, 1963 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 725 hits, more)
link thumbnail Acorn Elite Pages, The
The Archimedes version of Elite is widely regarded by experts (and myself) as the best installment of the classic game. This site features hints and tips, troubleshooting help, pictures, info on the Thargoids, many, many downloads, magazine articles and interviews, fan fiction, and links to related sites.
(Added 2003-11-12, 678 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 671 hits, more)
link thumbnail Adventure Classic Gaming
Dedicated to classic and retro adventure gaming. Reviews, exclusive interviews of developers and publishers, features on adventure gaming, and game cheats.
(Added 2006-09-24, 712 hits, more)
link thumbnail Amstrad CPC Hardware page
A few projects for the Amstrad CPC range of computers along with some techie articles out of English CPC mags.
(Added 2008-04-13, 518 hits, more)
link thumbnail Amstrad ESP es translate
almost complete catalog of Spanish games for the CPC, with screenshots and downloads, articles about Spanish software houses, cheats, and a forum; registration required!
(Added 2006-02-24, 1157 hits, more)
link thumbnail Articles on the History of Computing
Numerous articles on the history of computing and software engineering by Michael S. Mahoney, Professor of History at Princeton University.
(Added 2008-06-15, 486 hits, more)
link thumbnail Atari Bin, The
Atari timeline, Lynx and Jaguar FAQs and reviews, many articles.
(Added 2006-08-29, 668 hits, more)
link thumbnail Atari Times, The
Game reviews for all Atari systems, articles, columns, interviews, chat, forums, hi-scores, and more.
(Added 2006-09-14, 686 hits, more)
link thumbnail atari.area pl translate
Atari scene site. News, articles, forum, wiki, interviews, software database.
(Added 2006-09-03, 1275 hits, more)
link thumbnail Black Moon Project, The
We aim to become the premier resource for Philips CD-i related material. Including Reviews, Movies, Articles, Interviews, Boxart, Manual Scans and anything else that could possibly be related to the CD-i.
(Added 2007-01-07, 744 hits, more)
1 2 3 4 5 6 7 8 >   Next Page >>
Search:

Tags

remakeatari stxzxinstallersfaqssoftwareapogeesaturnsimcoupezopharmapscopiers.netmediamaking ofhintsrpgscp/mcastawayibmmo6multifacemike daillyatarimessplugincomputingtandypdfmamesnes9xsource codegplsfcapple 2gstype-incodescummvmadventure gamearcadebooksartworkgamebasepc-6000networkingtrailblazeracornunderdogsc64plus/4unreleasedresourcesamigasciteofpcegnuboyiaz-codefpsedelphicatalogmac plusstreamingarstechnicashmuplucasartsremakesonline playharvestjeff minterrichard bannisteremulatormerchandisecomputerfan artfolkloreconvertersexcerptmoviesdownloadpentagonhandheldrainbowatari stelinkssms plusolafnesmailing listgermangamearmx86fm-7versionsbard's taleseriesgp2xphotosftppasswordsqlhi-scoresscott adamscolecovisionamstradbiosid softwareadamrpgqnxbbcwiiepsoncompatibilitybabymega mansdkpokesspace invadersaction replayos/2pc engine65816mega drivesolarisdemo sceneendingswinuaesinclairmartin korthzx80assemblernesfrancecharles macdonaldrom hacksaltairduke nukemnintendomark3ukz80rom hackpalmosboulder dashluxorp2000supervisionfinal fantasyron gilbertclonesatari 8-bitpiratesfeatureasciiartscorpioncolumnsdoomdragonmz-800indiana jonesrottrisc osconsolesngpclittle johnsg-1000mastercreativisionshopbasicintroductionjaguarfreebsdxboxmz-80mp3hugues johnsoncps2gamasutraaixgenesis plusacademicsidconverterxm7manualngcdjrpgsgremlinddrllamasoftencyclopediafrodomuseumjavademodownloadsfanzinegamesdreamcastpsioncamputers lynxmusicvaxdocssierrafrontierimagesjapancommercialfinal burnjrpgdottinterviewnewsletterpandoracomputerstimelinemanualsphilipspetelectroncommodorestellacultureifralph baerspritesosf/1game boywikipediagrim fandangomonkey islandfusedosboxide68kvideosn64youtubepodcastoperating systemdingoowalkthroughssoundtracksti-92fellowxm6uaemacmodscartridgecensorshipcpuformatszaurusarcadiacreatorsvgbms-dos6502forumsegasf-7000fpgausenetappleconversionsovietspaintranslationswindowsaquariustutorialsarticlespsfgiana sistersfdsjswpasopiaik+patchessdluae4allkonamidemostcp/ipcomposersauctionskim-1dtvneo4allfcebeoscapcomspecsabc80emulatorselitesonicatari800archimedestvdebuggerhomepagebiographynecfirmwarepom1toshiya takedasnatchercopy protectioncollectingclubunmaintainedtgemuwikiarticlequotesopen sourcepsxhumorgizmondo8-bitndsboycott advancexgssgbodyssey2programminggithubbo zimmermancolemvcsspectravideoadventure gamesreviewsinterviewstechnotescd-inamcox68000solutionsnewslettersquasi88androidsega cdti-99/4atoolchainradiointerpretermtxcheatscalculatorinterpretersfujitsutrs-80emulationsunos32xwschead over heelsnvgvideo gamesgp32adsdumpingzx spectrumc16remixesatari 5200italyvbax1mipsarnoldvisual basicnsfabandonwarefan gamesvideocomicsorictooltaitolost sourcearchiveretrodevgifedgeintellivisionchronologyfan fictionto8handydma designti-89metal gearvic-20rom hackingpc-98bbc basicthomonlinewonderswanrick dangerousincompleteagismartphoneromspublisherjupiter acekigbbluemsxatomdescent3d realmshitchhikersymbianapple 2darcnespinoutsmupenhpmz-700ssemneopoppocketpcitjapanesemarat fayzullinapple 1mulemagnetic scrollsdavid foxcompressionpreservationwizmagazinecd32pcwgbahereticnewsmaniac mansionmo5pspgermanytutorialsoundsmshistoryinfocomgbccivilizationibm pclinuxreplicasultimafamtasiapowerpcgame gearosxhuccompilerc128commander keenmsxstrategythalionpeopleneo geoebaybugswalkthroughatari 7800unixhexenpc-88flashsmallspace questdatabaseflashcartsstudio 2iosguidemidirecompilercasiousfmsxngpreferencepv-1000geocitiesflyerstnknesterviceengineportrzxcsharpgradiusfm townsgallerysquaresoftnet yarozeopenglgeneratormarcel de kogelascii artcompilationspointlesslynxj2mewolfenstein 3dmaemofaqgp2xpectrumtoshibazx81pc-fxi18nmac ospcsxmagazinesanalysismagickitwinampdatasheetsscummcaanooarchivedgame designcharactersdiskmagsblogstoryto7windows celisahardwarebenj edwardsjum523dogccbox shotstriviatossc-3000snkff7basicneschip8virtual boyshmupsscreenshotsschematicskegssharewarecompetitiongraphicscoverscpcsam coupésonypaul robsonbooklibraryneopocottdnaps2pc98frenchplayersjumpmancocoinfonesbeebrom listingsmastertroniccartridgesvectrexmastergearscanstoolsddjzorkgamecubeguidescollectionastrocade