archive

<< Previous Page   < 1 2 3 4 5 6 7
link thumbnail VGMusic
Video game MIDI music from NES, Super Famicom, N64, Game Boy, Mega Drive, Master System, Sega Dreamcast, Sega Saturn, PlayStation, Atari, PC Engine, and other games.
(Added 2007-01-30, 345 hits, more)
link thumbnail Wizardry Page, WiredNerd1's
Manuals, maps, music, hints, and games for several platforms.
(Added 2008-03-04, 229 hits, more)
link thumbnail www.abandonware-magazines.org fr translate
Le site des anciennes revues informatiques. Tons of French computing and gaming magazines from the 1980s and 1990s for download in JPEG format. This is the site to check out if you want to know what gaming in France used to be like.
(Added 2006-07-07, 658 hits, more)
link thumbnail Zophar's Domain: PSF1/PSF2 Archive
PlayStation music archive.
(Added 2007-04-01, 468 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7
Search:

Tags

toolchainboulder dashgiana sistersfinal burnretrodevmulecreatorswindows cexm7z80sg-1000recompilernewslettersmusicti-89apple 2rick dangerousadventure gamecoversarchivejapanlynxfm-7space invaderslibraryllamasoftyoutubesdlstudio 2computersmastertronicultimacp/mbluemsxtrs-80ngcdbookradiofrenchhi-scoresmagnetic scrollssharpsource codejavapom1pandoracivilizationrom hackingtgemumtxgame designtosaction replayfirmwarejeff mintercalculatorromsscott adamsfanzinesupervisionconsolescopy protectionarmneslost sourcesaturnstorycollectingnet yarozepspwiztoolssolarisshmupssnes9xpsxbeebsam coupécomposerscinterviewsnsfron gilbertscansatari stculturereplicaskigbps2excerptzopharsdkmanualmachereticlittle johnbabyfan gamesralph baermonkey island8-bitpc enginednahintsxboxmega mangbcscineopopsc-3000lisaitalyplayersresourcesbooksspainstreamingmupengnuboyhead over heelsintellivisionpv-1000david foxnewsarchimedeskegsopen source68knvgcolemsinclairneo4alllinksatarimetal gearrom hackspetgermanyjrpgsthalion3d realmsti-92visual basicgeocitiesandroidatari 8-bitincompletehitchhikerrom hackddjoperating systemnetworkingdownloadcomputingdownloadsnamcovcsxm6wolfenstein 3daquariusgamepinoutsarticlesgremlinconverterfan fictionsmartphonevideomoviesgbalinuxcps2gamasutranintendozorkc128dragonapogeeduke nukemjrpgdosboxosxsms plusgamebasesoundtracksmaemotoshibahugues johnsonsovietto8x86compatibilitytnkmagickitjswtoolneo geoabc80caanooscreenshotsarchivedprogrammingemulatorscompetitionsoftwarehardwaremips3dopentagonideunmaintainedharvestteopsfunderdogsadsshopmike daillygithubatari 7800paul robsonusenetcocobbc basicik+ssemdottfamtasiabbcspritesvbac64apple 1featurecapcomto7powerpcmailing listmamepc98bugsdescentcharles macdonaldcolecovisiongradiusonlinepreservationinfocomlucasartswalkthroughszaurusgame gearndsflashmodsmultifacepasswordsxgsmo5itdma designdreamcastc16ebayabandonwarex1odyssey2compilerwalkthroughmagazinescompressionmac plusaltairpublisherflashcartswinampdiskmagsms-dosrisc ostechnotesgifpc-98aixrainbowiaacornngpz-codedemoswikiphotosconvertersthomapplebox shotsacademicmarat fayzullindatasheetswikipediaremakesflyersi18ntriviaqldelphireviewspokesxzxremixesmega driveonline playartworkp2000fcecomputergp2xluxorclubassemblerapple 2gsamigaformatspdfbasicnesbiographyarstechnicaspectravideopointlessgrim fandangorom listingsmidisolutionsremakeuktutorialsarticlepalmosvirtual boypasopiapc-6000ibm pcdarcnes65816enginecolumnsddrmerchandiseagirottgamescamputers lynxdatabasesymbiannewsletterfellowscorpionwindows6502pc-fxhandheldkonamimartin korthseriesemulationindiana jonescd32mp3pcsxpatchesscummasciiartff7sfcmaniac mansionascii artinterviewdebuggeranalysisatari 5200referenceendingsid softwaregplwinuaeuaegccfm townsatari stezx spectrumcartridgebard's taleboycott advancedemo scenecollectionsharewareguideforumdoomfusearnoldpodcastauctionshomepagen64arcadiaimagesifscummvminterpreterphilipssnatcherplugindemosonicrzxplus/4simcoupebo zimmermanhexenunreleasedtimelineshmupti-99/4arpgsfaqsquotesatomx68000.netbasiccensorshiposf/1chip8codemz-80richard bannisterjapaneseuae4allconversiontvgenesis plusgp2xpectrumcpuvgb32xwsccommander keenastrocadecommodorevectrexcompilationsusfrodoencyclopediamuseummediafolkloreadventure gamesinterpretersatari800francegeneratorsgbfpsesmsgizmondohistorymac osoricsegamarcel de kogelhumorgermandocssunoszx81tcp/ipjupiter acecasioadamcastawayepsonsidvideo gamesjaguarfrontiercharacterstranslationsstellastrategyjum52elitemz-700commercialmagazinefdsamstradblogdingoomz-800benj edwardssonypc-88chronologyqnxbiosngpcmark3smallgame boyunixrpgfpgaarcadespecsmasterolafnesfreebsddtvgraphicscopierscpcvaxmapstaitohpgp32introductionemulatorportvideoscatalogfaqmesspirateshuccartridgessf-7000sega cdversionspocketpccreativisionviceneopocottmsxzx80clonestoshiya takedamanualssquaresoftmaking ofspace questtandypsionschematicssnkpeoplejumpmanmo6fpcewiigalleryneciosbeosibmtrailblazerfan artnesterinstallerselectroncheatstutorialpcwopengldumpingmastergearj2mevic-20gamecubehandysierraftpwonderswanedgefmsxguidescd-iquasi88type-infinal fantasykim-1comicsfujitsuos/2infonessound