archive

<< Previous Page   < 1 2 3 4 5 6 7
link thumbnail VGMusic
Video game MIDI music from NES, Super Famicom, N64, Game Boy, Mega Drive, Master System, Sega Dreamcast, Sega Saturn, PlayStation, Atari, PC Engine, and other games.
(Added 2007-01-30, 360 hits, more)
link thumbnail Wizardry Page, WiredNerd1's
Manuals, maps, music, hints, and games for several platforms.
(Added 2008-03-04, 247 hits, more)
link thumbnail www.abandonware-magazines.org fr translate
Le site des anciennes revues informatiques. Tons of French computing and gaming magazines from the 1980s and 1990s for download in JPEG format. This is the site to check out if you want to know what gaming in France used to be like.
(Added 2006-07-07, 676 hits, more)
link thumbnail Zophar's Domain: PSF1/PSF2 Archive
PlayStation music archive.
(Added 2007-04-01, 498 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7
Search:

Tags

creativisionmanualjapaneseti-89mo6fan artto8n64japanpodcastrick dangerousintroductionplus/4namcoconverterz80demo scenearcadiamerchandiseimagestrailblazerhandyralph baerfreebsdlisabard's taletgemubasicnesndscolecovisiongbahereticpokescps2colemsegaemulatorsbasicgame8-bit6502lynxuae4allsdlgamasutraaltairdocsgalleryguideqnxjavafanzineron gilbertfolklorewizarstechnicapalmoshumorvectrexsierracommodorepaul robsonscott adamsdreamcastfpgamastergearfm-7winampzx80collectingbeebosxmagnetic scrollsboycott advancepcwneopocottneo4all32xsgbpointlessgame gearlittle johnxzxcartridgesusenettechnotesteotvmameddrgremlinromsrpgstcp/ipcensorshipflyersjeff minterti-99/4ageneratorstreaminggradiusatari stemulationcompetitionpasopiai18nmesshexenlucasartsmagickitzx81compilerspainpcsxmulestrategypsionrecompilerluxortnkapple 2gsmodshplost sourceatariartworksunosidedatabaseaquariusfaqtoshibapasswordsseriesrom listingsp2000networkingwscodyssey2atari 7800ddj65816dma designclonesibm pcftpxboxtrs-80cp/mvideo gamesmp3descentgamecubecpcshmupsbbcreplicasngpedgeatari800catalogcopierstutorialsbo zimmermanmacfuseendingscodedottcharles macdonaldculturevirtual boypandoramac plusremakesgame designdownloadti-92shop68kadamebaygp2xpectrumgraphicsmz-80ibmsmartphonefrontiercharactersstellapowerpcpsfgamebasefan fictionvic-20wikipediadavid foxcompilationsrpgchronologymipsrisc osfujitsuonlinegenesis plusneopopbenj edwardscomposersbbc basicifnestersupervisionbluemsxnintendogermanmagazinepiratesgcckigbunmaintainedvcstossoundtracksradiomultifacemz-700vgbrom hackssnkcocoonline playsoftwarebox shotstutorialfm townsmanualsdingooanalysisscigplassemblergrim fandangopublisherinfoneskegsfmsxsf-7000thomzopharrom hackdoomgnuboyrottolafnesioscasiobookjupiter acex68000j2meosf/1musicauctionsmartin korthopen sourceabc80remixesps2sam coupĂ©squaresoftsolutionsfeaturecoverssega cdfan gamesfpcegifacornmike daillysdkmailing listepsonwalkthroughreviewscomputingukpreservationfrodoinstallersencyclopediapeoplegithubcartridgeintellivisionpc98guidesgizmondocivilizationzaurusbeosphilipsarchivellamasoftpsxdemointerviewscopy protectionmaemoabandonwaredumpingcaanooqlblogformatsvisual basicbooksdtvarcadeadventure gamehardwareid softwarefamtasiakim-1pc-98homepageresourcesarnoldunreleasedfirmwarespace questsc-3000nvgwiimarat fayzullintranslationsshmuphi-scoresmasterto7adventure gamescalculatorcomicsmastertronichitchhikeratari 8-bitnecsfcportnewslettertriviaz-codesidgeocitiessonicspace invaderspatchesfrenchthalionspectravideoxgsdelphimega driveclubwalkthroughscomputersymbiansaturnconsolesgp2xamstradvaxmetal gearelectronadscommander keendosboxapple 1academicprogrammingcompatibilitydatasheetsoriczorkpc-6000wonderswanharvestatari stedarcnescd32wolfenstein 3drom hackingdebuggerspritesemulatorbiosscansaixtoolchainversionsunixindiana jonesplayersnewslettersduke nukemcreatorsopenglmz-800pdfjumpmanboulder dashsolarisc128cd-ichip8libraryuaelinksreferenceastrocadejrpggiana sistersusos/2ms-doswinuaesnatchergamesultimapentagonpluginasciiartfpseandroidmarcel de kogelmapssms plussmallstoryschematicshintsnesdiskmagspv-1000castawayssempom1pspvideoarmzx spectrumsharewarefellowx86appleaction replaysg-1000downloadsviceexcerptapple 2hucscreenshotsmidimtxpc-fxtoshiya takedajum52newsinfocomarchimedeswikimsxsovietmonkey islandagiinterviewmagazinesxm6articlesfinal fantasycheatsneo geoitalysnes9xmark3sharpcomputersscorpionmo5windowsarchivedapogeefranceyoutubequasi88game boyhead over heelsnet yarozecpuascii arthugues johnsonmedia3d realmsretrodevngpcpetik+linuxsmsngcdff7remakekonamitaitomoviesquotesvbaamigaelitecommercialscummvmfinal burnoperating systempc enginesonybiographyspecsjaguardna3dosimcoupeconverterswindows cetoolforumscummrzxhandheldunderdogscolumnsxm7bugsc16type-inmaking ofcamputers lynxbabygermanyjrpgssinclairinterpretertandymaniac mansiongp32x1c64atari 5200fcesoundfdstimelinemega manhistorynsfcapcomconversioncollectionsource coderichard bannistercmac osatommuseumincompletearticlepocketpcflashgbcphotosvideosflashcartscompressionjswtoolspinoutsengineinterpretersdragonitmupenia.netpc-88studio 2demosfaqsrainbow