archive

<< Previous Page   < 1 2 3 4 5 6 7 >   Next Page >>
link thumbnail R-Komeateez's Lynx Emulation
several Lynx ROMs for download
(Added 2003-11-12, 320 hits, more)
link thumbnail Retrocomputing Archive
Archive of commercial software; covers many platforms, but has a clear emphasis on CP/M.
(Added 2006-07-09, 297 hits, more)
link thumbnail Rom Hustler
Sizable archive with ROM and CD images for Atari, MSX, Nintendo, Sega, SNK, PC Engine, arcade, and many other systems. Each download starts after a delay of a few seconds.
(Added 2007-01-23, 414 hits, more)
link thumbnail ROMNation
Large web archive of Arcade, console ROM images for many and vintage computer games for a few systems. Relatively slow downloads; a simple captcha guards each download.
(Added 2007-11-05, 372 hits, more)
link thumbnail Self-extracting MSX MegaROM games
Archive of compressed, self-extracting MSX MegaROM cartridge for faster uploading to real-life MSX computers.
(Added 2006-10-03, 385 hits, more)
link thumbnail SEUCK Vault, The
Collection of games created with SEUCK (Shoot'Em-Up Construction Kit) on the Commodore 64 and Amiga.
The aim of the SEUCK Vault is to gather together the very best games created with SEUCK on the Commodore 64 and the Amiga. We are also looking for previously unreleased titles, your stories about how you used the Kit, and also the tips and tricks that make using the Kit easier....
(Added 2007-01-24, 227 hits, more)
link thumbnail SINCLAIR QL HOMEPAGE
Welcome to Dilwyn Jones's QL information and PD software download pages. All of the software here is only for the Sinclair QL and compatible computers unless otherwise stated, and is either freeware, PD, shareware or charity-ware unless explicitly stated otherwise.
(Added 2012-10-08, 384 hits, more)
link thumbnail SonAR
Archive of all Sonic games on cartridge.
This is a page created to document every single official, scene, and comunity recognized Sonic the Hedgehog related cartridge (backup) in existence.
(Added 2007-11-06, 303 hits, more)
link thumbnail Speccy Spoilers
Sinclair ZX Spectrum game endings archive.
[The author of this site has passed away in 2007. This entry links to an archived copy at WoS.]
(Added 2006-08-31, 260 hits, more)
link thumbnail speccy4ever
Firmware (including customized versions) and manuals for ZX Spectrum-type machines and peripherals.
(Added 2006-08-31, 255 hits, more)
link thumbnail Spike's Big Vectrex Page
Vectrex page with an emphasis on emulation and new overlays.
Site Highlights: Frequently Asked Questions 5.2, game instruction manuals, Realaudio of the Vectrex team speaking, both Vectrex emulators, complete links, ROMs for all original and new games, large scan gallery, screenshots, original/new overlays, various articles/utilities and curiosities, and The News...
(Added 2007-01-26, 389 hits, more)
link thumbnail Star Control - The Pages of Now & Forever
We the Safe Ones, the Spathi High Council, would like to welcome you to The Pages of Now and Forever. This site is an unofficial informational resource dedicated to the Star Control games from Toys for Bob and . The Pages of Now and Forever (PNF or PoNaF) were first launched sometime in the summer of 1996 and has since grown to become the largest, most comprehensive volume of Star Cont ...
(Added 2007-01-18, 465 hits, more)
link thumbnail Technical Documents
Techdocs for various consoles and CPUs at Zophar's Domain. The Sega, Nintendo, and PC Engine sections are well-stocked.
(Added 2007-11-06, 243 hits, more)
link thumbnail Thalion Software Webshrine
Information on the company, its employees, and the games it created. Includes extensive descriptions with screenshots, maps, and scanned magazine articles. Manuals, guides, and the games for various platforms can be downloaded.
(Added 2003-11-12, 423 hits, more)
link thumbnail Tools - Amiga (Plus/4 World)
Several Plus/4 for the Amiga for download, e.g. CP4, Flamingo, C16, and A4, plus libraries and tools.
(Added 2006-09-01, 326 hits, more)
<< Previous Page   < 1 2 3 4 5 6 7 >   Next Page >>
Search:

Tags

computing8-bitgermaninterviews3d realmsidemtxfreebsdtoshiya takedalucasartspsxnvgamigarecompilerconsolestranslationslinuxngcdngpchronologyid softwaremessfusepsionmanualzaurusdavid foxdtvcompatibilitysolarismacpdfcommercialmark3x86fpcepatchesultimapasopiamagickithandheldcik+infocomhistoryamstradsonydatasheetsc128space questmp3electronpsptoolchainnetworkingpocketpcarcadebard's talecheatsosxgame boyfirmwarevectrexatari 8-bitculturemz-80openglacornusenetportsega cd68ksquaresoftmerchandisetriviaandroidcp/mcodems-dosbiographyebayfrancearchivefm townsitiossgbtaitoapple 1composerscartridgesinclairscummbabymuleunixscreenshotsssemdelphiwindowsqnxhi-scoresdumpingmega drivecharactersagigizmondowalkthroughsfcelynxpc-98imagesodyssey2martin korthfrenchsg-1000newsletterscorpiontoshibarom listingsfm-7chip8ron gilbertsnatcherabc80atarifdsfrontiergraphicsbiosdebuggerindiana jonesbenj edwardspiratesdownloadneopopddjarmwindows cexboxgameinterviewrom hacksdemojumpmancastawaykigbneopocottmo6librarygnuboyff7final fantasyspace invaderssidcomputersscummvmwiisupervisionsharpremixesgrim fandangopc engineosf/1midimagazinesphotosrottcreatorssms plusscanshintsrichard bannisternesstrategyralph baerartworksoundtracksgremlinasciiartreviewshandyviceatomjum52flashtechnotesgp2xpectrumsmspasswordscommander keensnkcasioseriescensorshipflyersaquariusuaemanualssdklost sourceuae4allincompletecoversatari800competitionmonkey islandcollectingversionshucschematicsintellivisionshmupneo geoxm7abandonwarestreamingenginez-coderomscomicsarchimedesfmsxvcsfinal burnanalysisgame designwizmarat fayzullincopy protectionhardwarekonamialtairduke nukemi18nwalkthroughsnes9xsmallsaturntrailblazergermanyfolklorex1j2meteomodsrpgkim-1database65816net yarozegenesis plusto8zorkpc-fxngpcstudio 2columnsapple 2gsarticleresourcesremakespetpandorageneratorstellawikimaemocreativisiongplatari 7800dottluxormastertronicps2apple 2symbianjeff minteradventure gamejapanesemipsprogrammingbookdemo scenegalleryretrodevsdlllamasofttutorialsmapsastrocadefujitsuarchivedhugues johnsonblogcalculatorshmupsbookscolecovisionbluemsxassemblerforumscieliteto7gamasutraquoteszx81shopadsatari stefellowbbcnecpaul robsoncamputers lynxfan artconvertergcclisafpgasolutionsarcadiarpgsnesternewstutorialaixpcsxjupiter acebox shotsibm pcfaqneo4allsovietcompilations32xxzxdma designmo5installersspainsonicintroductioncartridgescivilizationcharles macdonaldpcwfpsetimelinecommodorejaguarnewslettersmailing listos/2flashcartsgeocitiessimcoupegp2xzx spectrummac plusmaking ofdosboxzx80linksradiotgemutoolssmartphonerom hackinghereticfeaturedreamcasttrs-80ibmrainbowvirtual boyrick dangerousinterpreterhumorpluginonline playguidescott adamssf-7000unreleasedx68000segaspecsthomboycott advancec64gamesftpnintendopc98marcel de kogelhead over heelspc-6000pom1playersoperating systemsierracd-imultifacemagazineatari stfaqsfan gamesapplebeeb.netatari 5200descentmac osonlineiakegsquasi88vic-20bugsstorywsctoolfamtasiamz-800frodoboulder dashhomepagepublishergamecubejavamupenddrbasicinterpretersyoutubeolafnesclubgradiusmz-700endingsvideossoftwarespritespv-1000tnkcompilercollectionexcerptspectravideojrpgstosvisual basicvideo gamesndsadventure gamescompressionconversiondarcnesunmaintainedwonderswanpalmoscomputervideocd32sam coupéemulationmaniac mansionascii artpokesti-99/4adiskmagscolemfan fictionhitchhikeraction replayunderdogscpucpcencyclopedia3domediagp32auctionssoundti-89sunosdragonjrpgcps2xm6mega manpsfpreservationjapanthalioncopiersbbc basicarnoldgithubpinoutsifusz80source codemovieswolfenstein 3dmamep2000pc-88academicgamebasemsxrzxreplicasformatsguidesfanzineharvest6502capcompointlessarstechnicaclonesbasicnesxgshexenhpedgeinfonesemulatorepsondoomdnapeoplerom hackpentagonc16tvwikipediagiana sistersnamconsfrisc oszopharcaanoovbaapogeedocswinampmastergearmasterpowerpcgbavaxn64oricremakeukgifopen sourceitalytandybeoslittle johnjswgbctype-inemulatorsmagnetic scrollstcp/ipplus/4dingoosfcreferencedownloadsconvertersmetal gearcatalogbo zimmermandemosmuseumarticlesadamsc-3000game gearti-92winuaemusicqlpodcastvgbphilipsmike daillycocoshareware