archimedes

1 2 >   Next Page >>
link thumbnail 4cheaters.de hot de translate
Large collection of hints and cheats for Acorn Archimedes, Amiga, Atari ST, C64, IBM PC, Sega Dreamcast, PC Engine, PlayStation, Game Boy, GBA, Super Famicom, Macintosh, NES, and others.
(Added 2007-01-09, 2080 hits, more)
link thumbnail A310Emu
Archimedes emulator for Risc PC and Iyonix.
An Archimedes-emulator for Strongarm-equipped RiscPC's & Iyonix ,for Arthur 1.1,RO2,RO3.1, memorysizes 0M5-16M (depending on OS). Sound and low-bit-per-pixel screenmodes must be improved. Supports two virtual ST506 harddiscs up to 256 Mb each. It's a work in progress, not everything works.
(Added 2006-08-17, 677 hits, more)
link thumbnail Acorn computer user WWW Server, The
Archimedes-related product info, documents, and technical information.
(Added 2007-11-08, 662 hits, more)
link thumbnail Acorn Elite Pages, The
The Archimedes version of Elite is widely regarded by experts (and myself) as the best installment of the classic game. This site features hints and tips, troubleshooting help, pictures, info on the Thargoids, many, many downloads, magazine articles and interviews, fan fiction, and links to related sites.
(Added 2003-11-12, 678 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 673 hits, more)
link thumbnail Acorn Technical Documents Archive
Archimedes-related technical documents, including many early ones, with a focus on hardware.
(Added 2007-11-08, 693 hits, more)
link thumbnail ArcEm
Archimedes Emulator for Unix and RISC OS. Open-source emulator of an A400 series machine. An emulator project that simply refuses to die, its ten-year release cycle notwithstanding.
(Added 2003-11-12, 508 hits, more)
link thumbnail Archiology
Relics from Acorn's past. Acorn Archimedes OS, test, demo, and development disk image archive. Archived at web.archive.org.
(Added 2006-10-21, 638 hits, more)
link thumbnail Arculator
Acorn Archimedes emulator for Windows.
(Added 2012-12-20, 368 hits, more)
link thumbnail Arthur lives!
Dedicated to Arthur, the Acorn Archimedes' original operating system. ROM image available.
(Added 2007-09-10, 704 hits, more)
link thumbnail asylum.acornarcade.com

SDL Asylum is a C port of the computer game Asylum, which was written by Andy Southgate in 1994 for the Acorn Archimedes and is now public domain. It should be possible to run it on any platform which support SDL and OpenGL graphics. It's developed primarily on Linux but has also been built successfully on Cygwin, FreeBSD, Windows and Haiku.

SDL Asylum is currently li ...

(Added 2007-09-10, 714 hits, more)
link thumbnail BBC lives! -- Emulators, The
Offers a large number of Acorn computer emulators for download, many of which do not have their own homepage (any more).
(Added 2006-08-31, 687 hits, more)
link thumbnail BBC lives!, The
The net's largest site catering for enthusiasts of Acorn's range of 8-bit micros from the eighties: the BBC models, Electron, Master and Compact, and to a small degree the Atom and Archimedes.
(Added 2007-09-12, 626 hits, more)
link thumbnail Icebird Acorn Demos
Archive of Acorn Archimedes/Risc PC demos.
(Added 2008-05-19, 464 hits, more)
link thumbnail RedSquirrel Emulator
Acorn Archimedes Emulator for Windows.
Red Squirrel has the following main features:
  • Runs in a window, or full screen for a more authentic feel.
  • 1/2/4/8/16/32 bit video support up to 1600 by 1200 (depending on model)
  • Full 8 channel 8/16 bit sound support (depending on model)
  • Access to the windows filesystem from within the emulator...
(Added 2006-08-21, 392 hits, more)
1 2 >   Next Page >>
Search:

Tags

mega mangenesis plusmupennewstandytriviapom1usjrpgszx81pc-98linuxff7hardwaremusickonamic128rick dangerousdelphicopiersstorypublisherxm6rainbowcomposersnesterculturesimcoupelost sourcetcp/ipbenj edwardspreservationdemo scenemtxsonycivilizationlittle johnnet yarozeelectronto7dumpingmanualpokescompatibilityimagesbard's talecomicsdatasheetsbo zimmermanwonderswanastrocadeibm pcunmaintainedngcdcoversnsfdiskmagsgremlinnvggifcocoinfocomarchivedcompilerflyersplayerslynxmastergeardatabaseaction replaymz-80cgrim fandangofmsxcomputingforummaniac mansionversionssega cdfinal fantasygermanyartworkrom hackingbeoslinksfreebsdarstechnicasymbianatomendingsatari 5200modsgeneratorneopocotthumorascii artmp3zopharatari stedge.netngppiratesindiana jonespatchesgraphicscollectingn64gamasutramamecolecovisionluxorc16chronologyfcelisagallerymac plusnetworkingsoundtracksgizmondorichard bannistertoolmulegradiussharewareukmacralph baerintroductionnespodcastcartridgespsxp2000ti-92underdogsdoomjavaatari 7800viceconsolessms plusandroidbluemsxflashcartsik+mz-700remakestranslationscompetitionsovietpluginrottsfceliteiosbugsformatsvisual basicdemodottbeebquasi88wizcommander keenshmupsebayemulatorpocketpccheatsconvertersbiographyx86seriespettoshibaassemblerfusedosboxtgemucastawaycaanooonline playzx spectrumssemoperating systemremakeosxgp2xwindowsscreenshotsunixultimamediaaixbasicnesdnaia32xintellivisioninterviewsmarat fayzullincodebooksyoutubetoolchainfaqsfujitsufm-7zorkamstradrisc osconverteremulationwolfenstein 3ditfan gamespdfgithubdreamcastfirmwaremapsquotesjumpmantospasopiatrailblazerspainvbagame designacademiccreativisionms-dosj2mepointlessgplpc98snes9xanalysisincompletejrpgz-codeftpmaemohexenitalygbawinuaeosf/1dma designboycott advanceharvestidearchimedescd-ijum52studio 28-bitsunoswalkthroughjapanneopopinterpreterxgswikisource codeshmupsaturnfanzinearcadiaepsonchip8smartphonecharactersdemoskigbodyssey2amigahintsapogeecommercialsam coupĂ©pc-88olafnesboulder dashopen sourcetimelineti-89pc enginemartin korthteogamesflashcomputerphilipsapple 2gsfm townsneo geoprogrammingphotosmonkey islandfpgaunreleaseddownloadsdebuggerreviewsmailing listresourcesapple 1interviewbooksoundsmstnktechnotesblogfan artmastertronicpsionstrategyfrodobbc basicvaxasciiartjswdownloadgeocitiesfinal burnron gilberttaitonecsdkpaul robsonhugues johnsonscicommodoresolutionsgnuboyfaqmo5compressioncreatorsarchivepc-fxadamguidesatariatari800winampdtvspace questsidllamasofthistorymultifacec64os/2magazinearcadefellowmetal gearpandoraxzxrzxnintendosf-7000biosmipscartridgevectrexwalkthroughshandyvgbclonesinstallersdocs3dorecompilerddjhead over heelskim-1enginecasioreplicasdragonpeoplexm7mark3gameguidearnoldmoviescopy protectionportarticleneo4allhandheldcolumnsmanualsx1capcomcomputerstoshiya takedainterpretersapple 2newsletterscensorshipmsxhi-scoresid softwarefrancecharles macdonaldlibraryplus/4pcwgp32gamecubeduke nukemtutorialsx68000dingooremixessnksierragp2xpectrumdarcnessonicpalmosclubdavid foxjaguarbbcarmsegahereticcamputers lynxmo6toolscollectionmerchandisefrenchgermanwikipediavic-20i18npv-1000uae4allfpceusenetscorpionaltairmarcel de kogelrpgsvirtual boyscansmike daillymagazinesscummstellaonlineadventure gamesqlpc-6000museumsnatcherromsnamcosdlspace invadersacornconversiontutorialatari stejapanesepcsxwindows cepspadventure gametype-insolarissgbsupervisionradioschematicsexcerptpowerpcpsfstreaminghucopenglsoftwarecpuemulatorsz80famtasiaagitvdescentgbcvideo gamesscummvmaquariuscps2lucasartsfolklorecpccatalog65816giana sistersrpgrom hackcd32ti-99/4afeatureifspritessinclairreferencearticleszaurusto8trs-80fan fictionmastersc-3000fdsgame boyhitchhikeruaemz-800auctionsrom listingsibmvcssmallnewslettermaking ofscott adamsvideo6502squaresoftxboxqnxspectravideondsmagnetic scrollsapplekegsbasicencyclopediaabc8068kvideospasswordsfrontierinfonesjupiter acejeff mintermesscalculatorcolemfpsebox shotspinoutsgamebasehomepagesg-1000gccwscps2sharpthalionmidispecsabandonwaremac os3d realmsrom hacksretrodevgame gearatari 8-bitmagickitngpcwiipentagonddrhpthomoriccp/madsshopbabymega drivecompilationszx80