academic

link thumbnail NES496
Incomplete NES emulator/debugger for Windows.
This NES emulator was coded as a result of a college assignment in CSE496, hence, the name NES496. It uses DirectX for drawing the graphics. It has partial sound, is rather slow, and only supports a few mappers. It does, however, have a cool graphical debugger. It's not really worth the download right now unless you want to play with the d ...
(Added 2006-11-23, 453 hits, more)
link thumbnail Project 51
NES emulator for DOS with sound but limited mapper support.
[Downloads have not been archived; get them at Zophar's Domain.]
(Added 2006-11-25, 377 hits, more)
Search:

Tags

japaneseinterpretersincompletesf-7000visual basicimagesms-dosconversioncompatibilitycpupc-6000saturnremixesopenglsgbos/2hitchhikersolariscocospace questintellivisionmsxpluginasciiartgradiusvaxcomputingmp3computercharacterssymbianllamasofttriviacaanooboycott advancevideojum52iostoolshardwareplayersatari 8-bittcp/ipuscnet yarozefellowddjvbajapanodyssey2commodoreunixcomposerspatchesoricjswfpsetnkepsonmz-800game designsmstype-infcexzxfm townskim-1converterpalmosmaking ofgrim fandangopandorajavaaixsidwscolafnesz-codegccbugsfdssnatcherlinuxwalkthroughspaincasioscreenshotsmagnetic scrollsti-92iasonysunoskigbyoutubearchimedesaction replayi18ngeocitiestechnotesbenj edwardspcwarstechnicacommander keenmapswindowsbox shotshistorymtxsharewarebiosdarcnesnvgtoolchainvgbron gilbertsoundnewslettertrs-80gifradiowinampjumpmanascii artunreleaseddemo scenegbcwizsam coupĂ©gamebasemanualsapogeeastrocadegameszopharabandonwaremesstgemugizmondocps2virtual boydreamcaststrategydatasheetsfaqifpc-98winuaepc98endingsdemosthomataric16mark3philipsseriesfaqskegsremakesnamcosharpmagickitneopocottrom hacksftpvcsbeebzorksimcoupenesdoomvideo gamesclonespspelectronpcsxmuseumconsolesbluemsxps2formatsemulatorpetgame boyabc80bbc basicpom1wiidma designmailing listfan fictionsega65816x68000remakeinstallersjeff mintermarcel de kogelsmallneo geoassemblerguidefinal fantasywonderswanmaemocomicsmagazinesoftwareandroidcomputersmuleforumschematicshucrecompilercalculatoratari800stellaamstradopen sourcehandyplus/4martin korthc64wikic128beosxm7frontiercastawaydottvideosarnoldgp2xtrailblazermultifacecreativisionsdkwikipediahandheldcompressionsoundtracksemulatorsquotessonic6502networkingbasicflyersinterpreterrpgngcdarcadedingoogbasfcdiskmagsfpgasupervisionjupiter acegamescansfanzinebo zimmermandelphibooksfirmwareitalyrzxcoversdatabasecopierscharles macdonaldsource codegermanywindows ceunderdogsnecrom listingsfujitsuapple 1lynxssempsxtoshiya takedaartworkmega driveindiana jonesgp32mac os8-bittutorialsapple 2cd-imetal gearduke nukemscorpionralph baerlibrarygeneratorrichard bannisterfinal burntoolatari stadventure gamegraphicsjaguarnintendomac pluspc-fxfrancepiratesarmti-89mo5jrpgsapple 2gshppointlessarchivegplcompilerusenetnewslettersintroductionretrodevneo4allfusedavid foxkonamimupenmediapsionrom hackingddrmoviesprogrammingsdltimelineik+freebsdsolutionspodcastadamrick dangerousmodsbiographysinclairmagazinessg-1000storyinterviewarticletvxgssnkgalleryosf/1shmupsx86ebayonline playcompetitionacademicmacndscollectinguaepc-88archivedti-99/4asovietcompilationsp2000zaurushexenmastercreatorscapcomcheatsatari 5200walkthroughsguidesmz-80sms plusff7ibmarcadiascummvmmastergeardescentwolfenstein 3dcodereviewspeoplegermansc-3000converterslittle johnchronologylisaauctionsjrpgagi3dostudio 2quasi88smartphonebbcmamecivilizationonlinedownloadsqnxporttoshibainfoneshead over heelsemulationvic-20newsdumpingvicedragonmarat fayzullinacorncartridgeluxorflashcolecovisiongame gearshophintsmaniac mansiontandygamecuberpgsmz-700gremlinrottfan artflashcartslost sourcecd32pv-1000resourcesfamtasiapsfqlibm pcdosboxcartridgesxm6encyclopediaj2medemobookclubdnamusicsnes9xmidispectravideoblogversionszx spectrumharvestfpcedebuggerlucasartsfeaturecp/mpocketpcculturehumorgenesis pluscopy protectionzx80fan gameshi-scores3d realmsunmaintainedvectrexsierra68kmega manscimerchandisefolkloretranslationsdownloadtosenginepreservationz80githubmanualads.nettaitozx81squaresoftinfocomreferenceto8nsfreplicasteomo6pinoutsrainbowcensorshiposxx1space invaderspublishercommercialexcerptcamputers lynxbasicnespentagonnesterdocscolumnsidegamasutraukapplescott adamsanalysisitcatalogmastertronichugues johnsonfrodoultimato7id softwarefmsxboulder dashbard's taleatari 7800aquariusdtvpaul robsonpowerpccollectionscummshmup32xchip8xboxrom hackcpcuae4allbabyfrenchromsngpceliteheretichomepagearticlesatompasopiathalionpc engineoperating systemedgephotosngptutorialmike daillyadventure gamesaltaircolemn64pdfspritessega cdstreamingfm-7specsamigagnuboypasswordspokesgp2xpectrumatari stemipsmonkey islandinterviewsrisc osneopoplinksgiana sisters