academic

link thumbnail NES496
Incomplete NES emulator/debugger for Windows.
This NES emulator was coded as a result of a college assignment in CSE496, hence, the name NES496. It uses DirectX for drawing the graphics. It has partial sound, is rather slow, and only supports a few mappers. It does, however, have a cool graphical debugger. It's not really worth the download right now unless you want to play with the d ...
(Added 2006-11-23, 446 hits, more)
link thumbnail Project 51
NES emulator for DOS with sound but limited mapper support.
[Downloads have not been archived; get them at Zophar's Domain.]
(Added 2006-11-25, 366 hits, more)
Search:

Tags

oricaquariusdragongnuboygiffrontiernsfpsiontrailblazerbluemsxlynxos/2freebsdgeocitiestype-ininfonespc enginespaincompetitionitalymagickitmulehardwaremessadventure gamegbafolkloreasciiartn64underdogspdfcpcguideschronologygermanfrenchbiographynintendotutorialscomputersarticlesapplec64linksarnoldpaul robsonsinclairpocketpcspace invadersphotoscollectingunmaintainedsoundinstallersrom listingsc128video gamesgamesscansforumcatalogpiratesagirom hackjapanradiosfcreplicasvisual basicspritesmo6zx spectrumzophararcadiaflashcartswindowscheatsconsoleslibraryhintsyoutuberpgwinampti-92game gearsnkllamasoftcarstechnicadtvkigbscihereticconversiongamasutraquotesromsneo4allzx80open sourceuae4allarmxzxfamtasiaaixatari 8-bitxm6uscartridgejrpgdescenthumorversionsdemoarticlebeostrs-80mike daillyfanzineplus/4newsletterreferencecpuschematicsmanualsplayersmerchandisevideosmz-800introductioninfocommiditoshiya takedapv-1000mapsneopopmagazinefinal burnremakesgp2xpectrumsms plusgenesis plusremakedemospatchesgp32apple 2shmupsfaqsmsmac ossquaresoftmastertronicinterpreter3d realmsgame boyhead over heelssonyamstradnvgflyersdavid foxstellaassemblerxboxdelphiremixesdatabasedma designifc16usenetcopiersjaguarsymbianadventure gamesfellowmo5pc-fxgalleryfrodoreviewsmp3cocoik+gamecubevic-20bbcmz-700ti-89excerpt6502vaxmastersdlmarcel de kogelcensorshipresourcesauctionssf-7000interviewtaitographicscharles macdonaldtriviascummvmmaemohugues johnsonoperating systemcolumnsmetal gearcoversmonkey islandodyssey2pspeliteibm pcdnaneo geogremlinpalmossnes9xosxgithubsupervisionosf/1marat fayzullinpc98linuxsolarisz80enginecasiopsxj2mendsti-99/4aendingsamigaaction replayvbacalculatortosretrodevhitchhikertnkiabugsvectrexartwork8-bitddrsg-1000wizvcsvideoultimahi-scoressierramipsgp2xdatasheetsrom hacksshopboulder dashmameron gilbertkim-1ngcdstreamingdownloadnewspandora65816vgbfcez-codeteospace questencyclopediamz-80jswmaking ofgbcscreenshotswinuaep2000hucdoomrisc oscompatibilityx68000specsfaqspcsxwscplugindemo scenesimcoupesega cdcopy protectiongradiuscapcomsaturnsnatcherkegs68karchivecartridgessovietdiskmagsgplfrancecd-iemulatorssharpsdkmartin korthfirmwarethalionduke nukemcomposerscolemgermanysharewarexgscamputers lynxhpsidtgemubookarcadepointlessatarifinal fantasycomputingsonicrichard bannistermega mansegasunosscummhandycommercialfujitsuastrocadedreamcastportgame designsc-3000windows cetoolsspectravideoatari sterecompilerimagesfan fictionscott adams3dopcwtranslationshexenabandonwaredosboxdumpingbo zimmermanjumpmanaltairwiiformatsbasicnesjeff minterx1namcoharvestmodsi18nnecitpowerpcrick dangerousgiana sisterscolecovision.netmagnetic scrollscaanoomusicbabyvicepokesms-doscultureolafnesmaniac mansionunreleasedmanualincompletegizmondoscorpionatari 5200fmsxbookscommander keenabc80little johncompileribmblogzx81macstudio 2pc-6000fpgachip8preservationemulationadsgamebaseadamcp/mandroidqnxtechnotesmsxtoshibahandheldpodcastpc-88apple 1storypetralph baerquasi88ebaybbc basictoolchaincharacterssam coupĂ©magazinestutorialapple 2gsseriessource codemega driveacorngeneratorhistoryidetvpc-98guideftpid softwarewalkthroughsdocsuaevirtual boy32xnewslettershomepageprogrammingindiana jonesdingoocompilationssmalltcp/ipfuseacademicstrategyatari 7800onlinelucasartsfpselost sourceff7castawayx86javato7thomcivilizationwolfenstein 3dpom1gccwalkthroughbox shotsfdsluxordottzorkrom hackingcomicsatari stcd32publisherpasopiaelectronfeaturerainbowssemfan artcommodorengpcarchivedfpcesoundtracksunixclubcreativisionfm-7epsonmtxflashjupiter aceneopocottcomputercreatorscps2compressiondownloadsmark3mailing listbiosjrpgstoolnestimelinemoviesmuseumpasswordswikisoftwareedgesgbboycott advancenet yarozeiosbasicatomrpgsascii artddjps2bard's taleopenglpeopleanalysisxm7beebwikipediaonline playarchimedesinterviewsmediaemulatornestergamemultifacegrim fandangowonderswaninterpreterszaurusukphilipsngpcollectionmastergearkonamiconverterconvertersmupenpentagonjapanesejum52smartphonepinoutsfm townsrottshmupqlclonesdarcnespsfatari800to8rzxfan gamessolutionsintellivisiontandyapogeenetworkingmac plusdebuggerlisacodebenj edwards