Details: Aphrodite

Aphrodite 


NES emulator for DOS.
Its very archaic, playing very few roms with minimal sound support.
[Entry points to emulator archive at Zophar's Domain.]

URL: http:/​/​www.zophar.net/​nes/​aphrodite.html
Category: Top:/Emulation/Emulators/NES/Unmaintained and incomplete
Language(s): en 
Tags: archived emulator incomplete nes

Added: 2006-11-17
Updated: 2013-01-17
Hits: 461

EDIT
Search:

Tags

merchandisehomepagelinksgradiusbo zimmermanjavarpgsmsxendingsms-dosfellowgbadavid foxrom hacksgamasutrabluemsxreplicasstorynewsletterscommercialscivectrexsegassemcompileruae4allabandonwarescott adamsto8final fantasywindowsifultimamanualmultifacefujitsudownloadspecscharactersrisc osquotespasswordsarmfan fictionzauruspalmossg-1000c128camputers lynxexcerptndsprogramminggithubplayerscompressionpcsxti-92infoneshandheldtaitoarnoldsolutionspeoplescummvmgame designrpgosf/1acornarticleteohandyemulatorwinuaesfcadventure gamesmagazinesmsmapsapogeecopy protectionn64engineretrodevjrpgngcdsf-7000sinclaircomputerps2intellivisionibmnesterkegsff7clubmagnetic scrollsmp3head over heelsrom hackingvideosbbci18nluxorlucasarts68kcivilizationrick dangerousseriesinstallersdreamcastconsolesukzx81pinoutsdingooc64dosboxiosfaqcoversatari 7800sierrasonymediafolklorecartridgeplus/4colecovisioncommodoresgbti-99/4aarcadepocketpcwscneopopitaly.netmaking ofmz-800rzxtoolapple 2gsvic-20jumpmanamstradtoolchainstudio 2elitemidimastergearnvgpspsharpqlgamebaseradiogeocitiesstreaminguaepetdiskmagshumordelphiphotosspace questbasiccps2copenglrottphilipssonicbiographynintendoforumjum52databasebooksx86open sourcefan artgame boygamecubekonamicpupom1auctionsdma designdatasheetsvirtual boyabc80resourcesemulationmtxadventure gamewalkthroughsscansataricp/mz-codetvgremlinmega manarchivedsoftwaregifelectrontoshiya takedaneo geostellagenesis plusto7hugues johnsonfpgaduke nukemtandysolarisrainbow8-bitpaul robsongiana sistersremakesik+trailblazerpasopiac16emulatorsllamasoftebaylisacartridgessupervisionfm townstimelinesource codeolafnescomputersanalysispandoracommander keenhintscreativisionsimcoupeportwinampdownloadsatari 5200tcp/ipascii artdocswalkthroughconverterspodcastfpsecolumnsarticlesos/2codemega drivehucintroductionpublishermodsdtvunixdumpingcopiersinterpretersmamepc-98historywikivcscaanooconversionosxasciiartmasteramiganewsnamcokigbcalculatorlost sourcehitchhikerdebuggerfrenchdemo scenepdfvideo gamesngpcheatspointlessmo5z80famtasiaincompleteapple 2ngpctosinfocomfmsx3doid software65816game gearadamddjjeff minteratari 8-bitibm pcaixsmartphonespace invadersfcehardwarezorktutorialgrim fandangocharles macdonaldsdlzx80astrocadeaquariusgeneratoryoutubepsionbiosfanzineralph baerlibraryremixesfreebsdx68000metal gearguidemike daillyarchimedescensorshipjupiter acetrs-80frontierversionscd32odyssey2sidgp2xcpccomposerstoshibaflashcartssnatcherpowerpccocoquasi88smallartworkjrpgscapcommaniac mansiononline playmartin korthpsxnewsletteratari800onlinechronologynecsega cdmagickitfirmwarecompetitionx1wizreferencegraphicsremakehpmarat fayzullinqnxhexenmonkey islandfranceitvbajapaninterpretercomicsvisual basicbugsfaqspv-1000jaguarron gilbertjapanesesc-3000interviewpokesneopocottxm6thomvaxgnuboyreviewsgp32spectravideodragonfm-7ftpmarcel de kogelfpcecomputingimageswikipediaarstechnicatype-inbabypsfsam coupĂ©descenttoolspcwzx spectrumtranslationsmagazinesstrategymastertronicxzxcolemdemosgermanboulder dashiamo6nsfwindows cesnes9xcreatorsspainsovietatomepsonti-89vgblynxtutorialsmailing listblogtgemubard's taleidecompatibilityvicexm7soundtracksapplepreservationmesscloneslinuxbeosgamecasiogizmondogalleryarcadiasharewaremark3hereticguidescompilationsencyclopedia3d realmsshopgamestechnotesandroidboycott advanceagilittle johnfusegccsms plususenetdemoxboxdnanet yarozeharvestsnkdarcnesassemblermz-700schematicspiratesjswtriviamac osatari stnesacademicfinal burncd-idoomrom listingsscorpionchip832xsquaresoftmanualsromsfan gamesddr6502pc-fxmuseumpentagonrom hackfdsindiana jonespc98zopharapple 1atari stevideointerviewssymbianj2mebbc basicmaemowonderswangbcpc-6000altairmacmupenmz-80collectingsunosfeaturebenj edwardsarchivedottfrodoflyerscollectionbasicnesunreleasedbookhi-scoresconvertergp2xpectrumgplwiioricneo4allp2000soundnetworkingunderdogsadssdkshmupstnkspritesflashcastawayscreenshotsshmupkim-1patchespluginbox shotsscummwolfenstein 3doperating systemthalionformatscultureunmaintainedrecompilermoviesmac plusbeebcatalogpc enginemulepc-88mipsxgssaturngermanyrichard bannisteraction replaymusicusedge