Details: Pete's Domain

Pete's Domain  hot


Home of several excellent (and unmaintained) plugins for PlayStation emulators.

URL: http:/​/​www.pbernert.com/​
Category: Top:/Emulation/Emulators/PlayStation
Language(s): en 
Tags: emulation plugins psx unmaintained

Added: 2003-11-12
Updated: 2014-02-22
Hits: 1129

EDIT
Search:

Tags

little johnscitimelinec64mastertronicpluginifsymbianpinoutsnesterinfonesgamecuberick dangerouskonamisnatcherluxorflyershistorycp/mgifscott adamsgbasaturnnewsletters8-bitnet yarozehomepagesierragame boyrainbowik+68kcharactersz-codevideollamasoftplayerscultureos/2networkingedgedatabasewalkthroughiosto7artworkolafnesgp2xsms plushereticgalleryx86assemblerfaqsbasicatari800arstechnicandsconverterssega cdkigbjrpgmega driveastrocadetutorialtgemumsxsmsspecswsccharles macdonaldpodcastschematicscopy protectionron gilbertcpuyoutubeblogunreleasedbeosxgsimagespentagonvbapv-1000toolssnkdarcnesn64forumitalybooksdocsandroidboulder dashmaniac mansioninstallersmoviesrpgsfanzinescummvmharvestdownloadpalmospowerpcspectravideoftpfrenchgamebasetossoundtracksgame designbabycaanoounmaintainedaltairpsxcreativisionodyssey2tvcompressionmultifaceversionsgame gearff7kegsfinal burnsharewaremac osgeneratorgamesfrodoascii artatari 8-bitms-dosdelphigamasutrazx spectrumnvgfm-7space questfinal fantasytranslationslost sourcecps2dragonid softwarehumorsidgamearchiveconsolessunoscocomailing liststreamingtnksonicsoundmarcel de kogelgplnesinfocommo6making ofcd32adsretrodevwonderswan3dojrpgsgizmondodescenttutorialscoversjaguarplus/4analysisibm pcc128sdkjapanesevideoshintstrailblazernewsdingooto8portdemocommodorerotttoolpreservationebayjupiter acefmsxneopopreferencecomputergermandownloadspc-6000ultimassemhandheldbo zimmermanapple 2cd-isf-7000fpgaflashcompileribmmagazineshandyfpcereplicaspointlesspdfscummfm townshpgbcddrshopgrim fandangotrs-80xm6video gamessc-3000teoapogeemanualwolfenstein 3dqlcreatorsarchivedrpgtoshiya takedafujitsuddjxboxrom listingsstorywindowscollectingspritesarnoldcompetitionencyclopediapaul robsondavid foxlynxbiographyx1francestellaacademicusenetpcwfan artwinuaei18ncommander keenoperating systemseriesbugsguidesjumpmansolutionsepsonvic-20modssg-1000onlineshmupsatomsgbsquaresoftmasterdatasheetsitsource codecopierspsionzaurusinterviewswinampbasicnesgiana sistersamigaagiarchimedescolecovisionbooktaitoosf/1demo scene65816ngcdlibraryromssfcsupervisionintellivisioncensorshipthalionfirmwaretoolchainmega manfdspokespom1triviapc-98adventure gamesinterpretersinterpreterti-92neopocottengineaquariusgraphicsapplesinclairpc-88ideclubvirtual boychronologydtvauctionsmagazineshmupchip8bbcsnes9xlucasartsmp3wikimaemognuboyphotosgithubcatalogindiana jonesopenglvaxclonesvicepsfnamcouaecasiobenj edwardspc98gp32atari stpiratesti-89diskmagscolemrom hackinglinkspasopiaendingsformatsrecompilergermanythomti-99/4apc engineralph baerqnxremixesrom hacksunderdogswizphilipsatari stestrategyatarisdlmagickitaction replayxzxhexenemulatorcompatibilitydnazopharcommercialfeatureconversionpublishernintendojavarom hackmidimusicadventure gamedoomcheatsscorpiongeocitiestcp/ip.netzx80eliteincompletespace invadersuae4allduke nukemgremlinx68000spainpeoplevisual basiczx81civilizationabc80fcesolarismediacolumnsnsfcapcomtoshibasegaaixpandorafan fictiondemosscreenshotscpccomicsjapannecc16composersmamepcsxhucfellowiaoricjum52richard bannisterresourcesmike daillynewslettertype-inbeebwalkthroughs3d realmsgp2xpectrumcalculatorneo geodma designmanualsmuseummacreviewsmz-800vgbstudio 2head over heelspatchesmac plussharpmessfuseusadamkim-1collectionmagnetic scrollswikipediapspbbc basic32xdosboxcomputingcomputersguidewiiinterviewngpcuklisamo5online playmuledottbard's talepocketpc6502mastergearscansboycott advancerisc osz80zorkrzxbluemsxhitchhikerdreamcastngpdebuggerbiosmarat fayzullinfan gamesj2mepetasciiartcastawayfpsecartridgeconverterelectronmz-80mipsjswmartin korthmapstechnotesemulationjeff minterarticleremakeexcerptbox shotscamputers lynxtandyquotescartridgesmtxmupencps2gccamstradquasi88metal gearcompilationshi-scoreslinuxsmallpc-fxsoftwaremz-700vcssmartphoneremakescodesam coupĂ©folkloregradiusapple 2gsunixsovietacornprogrammingfaqapple 1genesis plusflashcartssonyfreebsdxm7simcouperadioatari 7800armmark3abandonwaremonkey islandvectrexfrontierhugues johnsonneo4allarcadearcadiaemulatorsatari 5200osxhardwareintroductionwindows cep2000famtasiamerchandisepasswordsopen sourcearticlesdumping