Details: Free64

Free64 


Unmaintained and simple C64 emulator for DOS.
Free64 is a Commodore 64 emulator for MS-DOS, written solely by me, in Borland C 3.1. I wrote the CPU core myself, although I used M6502's implementation of BCD arithmetic as an example. Here is a list of current features: (as of v.01)
  • 6510 CPU, full documented instruction set
  • RAM/ROM switching
  • CIA 1/2 timers A and B
  • CIA 1 Keyboard, Joystick
  • CIA 2 CBM Serial Bus access via parallel port, using X1541 cable (the same cable as for Trans64, C64S, Com1541, Star Commander, etc.)
  • T64 file access (on reboot only, no live access)
  • Minimal VIC ][ textmode with limited color, bank-switching
  • Minimal SID voice 1 through PC speaker (mostly so I can tell if a program is running if the VIC isn't working)
[Download has not been archived; get it at Zophar's Domain.]

URL: http:/​/​web.archive.org/​web/​20050508191033/​http:/​/​home.comcast.net/​~brad.martin1/​c64.htm
Category: Top:/Emulation/Emulators/Commodore
Language(s): en 
Tags: archived c64 emulator incomplete ms-dos zophar

Added: 2006-08-17
Updated: 2013-01-16
Hits: 340

EDIT
Search:

Tags

pv-1000messjapanesedescentatari800sg-1000converterszorkneopocotteliteidetechnotesto8libraryx86specswonderswanreplicasti-89beebsms pluscharactersendingsvic-20masterdoomti-92fanzineenginehexenbard's talengpcpetpinoutsreferencen6465816germanysymbianpc-fxsega cdrisc oscococonversionphilipssierraspaincp/mcollectingnewsjapandemoanalysisjrpgamstradndsinterpretersc64david foxremakes3d realmstoshiya takedatrailblazeriaconverterultimacolumnsid softwareemulatorformatsfpceatomboulder dashstellabeosmanualsgame designsoundtracksvirtual boyibm pcjupiter acemuseumitalywscretrodevpalmosadventure gamemike daillyhead over heelsinstallersnvgonline playxm6rick dangeroushitchhikerdownloadhardwaremaking ofgamebasefaqsc128konamipasswordspodcastinfonesflashcartsff7apple 2gsjaguarunderdogsgermanpsionshmupssinclairpc-98z-codeemulationolafneskigbnesclubshmupplus/4giana sistersc16game geardingooindiana jonescomputersz80edgeinterpretercatalogfusep2000incompleteclonesoricqlpcwsquaresoftsam coupĂ©solarismediaarstechnicabo zimmermanpandoracompilationscommodoresmartphoneascii artcd-iteodemo scene8-bitadscoversfeaturecinfocomrottrzxtype-invgbgbaunmaintainedremakepc98pdfdocsserieskegsatariversionsdarcnesfm townsfdsmagazinenewslettersciunixrichard bannisterbabyddjfolklorewikipediaabandonwaremacgp32neo geopreservationguidehi-scoresrpggeneratorbooksinterviewsmark3psprom listingscomposersvisual basicarchivecreativisionmagickitgbcnsfculturebbcarchivedrpgsnewsletterscomicstutorialsmidiasciiartcolecovisionfaqacademicti-99/4abasiccapcompeoplecpcintroductionepsonfrodolinuxddrneopopfirmwarefpgawindows cehintsjrpgszx80iosbbc basicsf-7000agipentagonthomfinal fantasyrom hackingzophartriviawalkthroughmamecheatsmac osresourcessegadosboxhumorcartridgesstrategycommercialvideo gamesvcsi18ncpuspritescopy protectiontcp/ipthalionportdatabaseadamj2meabc80moviesemulatorstandygp2xpectrummastergeargame boydatasheetsfcefinal burngamessdkhugues johnsonjum52ms-dosarticlesbugsitdumpingosxvicenetworking.netjumpman3doarchimedescensorshipllamasoftnamcodemosjswpc-6000sdlartworkduke nukemtutorialmastertroniccalculatormodstoolchainmac plusfan gamesmultifacewalkthroughsbluemsxspace questjeff minterukapplecompetitionvideoebaypsxintellivisionvbacasioxzxcompilerchip8commander keenflashibmgithubbenj edwardsconsolescastawayschematicsnecscummvmscreenshotsmagazinespsfastrocadestreamingmerchandisecopiersdottpatchesharvestsource codesoftwarehandycharles macdonaldbiosgamecubeassemblertranslationsprogramminggifapple 2apple 1mailing listx1biographygallerysfcflyerssnkmapsgeocitieswindowsluxorhucrecompilersidpublisherzaurusremixesgp2xamigafamtasiasovietbasicnesjavaarnoldsharpatari 8-bitdragonmz-700pirateshereticgradiuscreatorsbox shotsifsgbxm7tgemupointlessshoplinkssmallphotosgccmp3usenetsonicrainbowcamputers lynxfrancecd32aquariuspc-88space invadersmusicdownloadsosf/1storypcsxdnaexcerptcodesonysunosodyssey2vaxadventure gamescomputerpom1mz-80msxauctionstimelinemtxelectronguidesspectravideouaedebuggerssemmetal gearx68000onlinewiimega mangamasutra6502vectreximagesaltairstudio 2lisadiskmagsralph baerpowerpcgenesis plusinterviewarcadiapc enginesimcoupehistoryngcdmagnetic scrollsmupenqnxmo5wikifrontiermulegplatari 5200trs-80little johnfmsxhphomepagefujitsutvdma designmarcel de kogelrom hackscivilizationfrenchscott adamscartridgeapogeetosdreamcastcaanooromsftpencyclopediaatari stps2mo6uae4allpokesgnuboymartin korthsoundradiogizmondongpsolutionskim-1cps2fan fictionlynxopen sourceboycott advancetoshibachronologysaturncompatibilityik+wolfenstein 3dto7fellowwinampwinuaesupervisiongremlinoperating systemacorntoolscorpionmz-800delphisc-3000handheldscummpluginnet yarozesnatchergraphicsos/2usgameopenglyoutubemaniac mansionvideoslucasartsatari 7800zx spectrummanualneo4allron gilbertfm-7aixmonkey islandzx81scansfpsedtvpasopiasharewarexgsunreleasedpaul robsonreviewslost sourcearticlearmsmsblogtoolsnesterfan artxboxcompressionnintendoplayersandroidforumtnkaction replaycollectioncomputingrom hackmega drivequotes68kmipsbook32xquasi88grim fandangomarat fayzullinfreebsdwizcolematari stepocketpcmaemosnes9xarcadetaito