New links

link thumbnail uli/huc · GitHub
Enhanced version of the PC Engine development system HuC.
By this author.
(Added 2014-11-17, 1547 hits, more)
link thumbnail Atari Computer Books
Books related to the Atari line of computers, including the Atari 400, 800, ST, XL and XE. Subjects covered include software, hardware, programming, design, and copy protection. Scanned by a wide range of contributors. Many of these items came from the efforts of atarimania.com.
(Added 2014-11-17, 1549 hits, more)
link thumbnail All PSX CAETLA Versions and CAEFLASH (PSXDEV)
PlayStation development tool for download that can be used on an Action Replay or equivalent hardware for development.
(Added 2014-11-17, 1576 hits, more)
link thumbnail Commodore Amiga Manuals
Manuals, instructions and schematics for the Commodore Amiga family of computers.
Collection at the Internet Archive.
(Added 2014-11-17, 1579 hits, more)
link thumbnail Commodore C64 Manuals
A collection of manuals, instructions, schematics and information pamphlets related to the Commodore C64 computer.
Several hundred C64 game and application manuals.
(Added 2014-11-17, 1579 hits, more)
link thumbnail Commodore PET Books
Collection of Commodore PET-related books at the Internet Archive.
(Added 2014-11-17, 1580 hits, more)
link thumbnail Commodore C64 Books
Collection of Commodore 64-related books at the Internet Archive. Also contains many titles about the VIC-20, C128, PET, and other Commodore computers.
(Added 2014-11-17, 1582 hits, more)
link thumbnail SDL Lopan
An SDL-based Shanghai clone with a very basic interface.
(Added 2014-11-15, 532 hits, more)
link thumbnail I ♥ The PC Engine (Magweasel) cool
Kevin Gilford's excellent reviews of PC Engine games and related items providing a lot of historical background.
(Added 2014-03-04, 1204 hits, more)
link thumbnail Video Game Den
Video Game Den is a one man crusade to help share his knowledge and passion for Japanese classic video gaming in the 80's and early 90's. You will find here hundreds of Famicom, Famicom Disk, Nintendo Entertainment System (NES), Super Famicom, Super Nintendo Entertainment System (SNES), PC Engine and Turbo Grafx 16 game reviews and a lot more. Please enjoy your stay.
"Mor ...
(Added 2014-02-28, 813 hits, more)
link thumbnail XM7 for SDL enja
SDL port of Fujitsu FM-7 emulator XM7.
(Added 2014-02-23, 923 hits, more)
link thumbnail XM6 Pro-68k
This is the most powerful X68000 development tool in existence today. It is a fork of version 2.05 of PI's abandoned XM6 emulator. The changes are mostly user-interface related, and the focus is on development and debugging features rather than accuracy of emulation; however, it has enough general-interest improvements that I'm confident in recommending it over XM6 version 2.06 (the fi ...
(Added 2014-02-23, 1013 hits, more)
link thumbnail pcsx-df
PCSX-df is a fork of the PCSX Playstation emulator designed specifically for GNU/Linux (and probably other similar systems). It has a completely reworked and modernized GTK2/Glade GUI, integrated plugins, an improved system for classic PSEmu plugins, better configuration tools, support for translation, easy installation, and support for AMD64.
(Added 2014-02-22, 580 hits, more)
link thumbnail PCSX-Reloaded
PCSX-Reloaded is a PlayStation Emulator based on PCSX-df 1.9, with support for Windows, GNU/Linux and Mac OS X as well as many bugfixes and improvements.

Note: This project is affiliated with neither PCSX nor PCSX-df project and should be considered as an separate derived work, so please don't confuse this project with the original PCSX or bother the original PCSX developers ...
(Added 2014-02-22, 683 hits, more)
link thumbnail ZXemu
Spectrum emulator for Psion 3 series handhelds.
  • compatible with Psion 3a, Psion 3c and Psion 3mx
  • highly optimized emulation core written completely in assembler
  • undocumented Z80 instructions and R register fully supported
  • 3 color modes (INK, Black & White, Gray)
  • 3 screen mapping modes (Pan, Shrink, ...
(Added 2013-02-25, 790 hits, more)
link thumbnail xpectrum
ZX Spectrum 48K, 128K, Plus2, Plus2A, Plus3 emulator derived from gp2xpectrum by Hermes/PS2Reality and continued by Metalbrain & Seleuco & SplinterGU.
xpectrum is ZX Spectrum emulator that could be easily port to various hand-held devices.The purpose of this project is to bring together the develop efforts to port to differents platforms.
Currently it includes support for SDL ...
(Added 2013-02-13, 761 hits, more)
link thumbnail VPCE
PC Engine emulator for DOS.
[Downloads have not been archived; the DOS binary can be found at Zophar's Domain.]
(Added 2013-01-24, 757 hits, more)
link thumbnail vGBX
vGBX is an open-source Java Applet that emulates the Nintendo Game Boy (GB) and Game Boy Color (GBC), released in 2010. vGBX is a fork of the excellent JavaBoy by Neil Millstone, which was in development from 2001 to 2005. Most of the differences between vGBX and JavaBoy are interface-related, code cleanup, and fixes for issues that popped up in newer versions of the JVM.
(Added 2013-01-16, 797 hits, more)
link thumbnail ClassicSegaOnline
ClassicSegaOnline is an open-source Java Applet that emulates the Sega Master System / Sega Mark III and Sega Game Gear, that was initially released in November 2012. ClassicSegaOnline is a fork of the excellent JavaGear by Neil Millstone, which was in development from 2002 to 2008. The biggest difference between the two projects is the higher-performance timing code in ClassicSegaOnli ...
(Added 2013-01-16, 928 hits, more)
link thumbnail Oh Boy
Oh Boy is a port of the gnuboy Gameboy emulator with a basic menu system. [...]
It runs on:
  • Linux x86
  • Windows (32 bit), e.g. Windows XP.
  • Dingoo Native A320
  • OpenDingux for GCW0 and Dingoo A320 - Also Old Dingux Dingux blog
  • Caanoo
(Added 2013-01-10, 696 hits, more)
Search:

Tags

schematicsmo5sonygccshopcp/matari800ebaymagickitpc-6000computerpsionspaindotttype-inwindows cefrontierp2000youtubecreatorsasciiartcasioibm pcpsxgnuboyedgelisanewsmesscopiershitchhikerstellalinksmanualsscummteospace invadersarchivej2mei18nnewsletterscd32gamasutracharactersjapanfusebiosgithubmp3versionsgame boyxzxgizmondoccivilizationusenetpetcreativisiondarcnescollectinginstallerswalkthroughradiotcp/ipagiadsvbato7specsphotoskegsscreenshotsformatsmega maninterpreterx86os/2dreamcastzx81infonesnvgbiographycompetitionpdfkigbmasterbeebid softwaresgblinuxfpgabookgradiusgame designgeocitiesifpandorazorkfreebsdhardwaredosboxvgbtnkscummvmmusicfinal burnwiirom listingsnet yarozestreaminggp2xpectrumto8tgemusaturntoshiya takedainterpreterspointlesscamputers lynxfrodocd-ic128sunosdatabaserichard bannistertimelinemarcel de kogelbeosz80clonesscissemreplicassmallpc-88neopocottshmupgbccartridgemulemac pluscommander keenfellowatari stvic-20snes9xhugues johnsonamstraddocsarchimedesdownloadmodsdemosmac ostandybugsflashcartsbard's talebasicunmaintainedmz-800source codeacorncolemserieslibrarypluginmaniac mansionadamabandonwaresupervisionpcsx68kcompressionbo zimmermanauctionsgp32remakeoperating systemwonderswanibmpeoplesymbianfpsevideojaguarwizmz-700famtasiablogatari stesc-3000mo6calculatoratariuaeneo geoatari 7800censorshiprisc osatari 5200fm-7caanooquotesbluemsxatomcomposersukscansnewsletterapple 2open sourceaquariusjrpgsflyersdavid foxfeature65816iosarnoldgermanymark3soundimagesmega drivepsfencyclopedianamcocommodoredescentpcwgamebaseonlinen64aixrotttaitosonicngcdastrocadex68000intellivisionrick dangeroushpstorycastawaywikiportitalydoombasicneskonamiboulder dashluxorrecompilersf-7000ftpfrancetutorialstoshibahintsc64mike dailly3domuseummailing listgremlinthalionodyssey2rom hackingromsmsxarticlesjswhereticunderdogsgbasolutionsshmupsflashfcecps2sg-1000dma designsegafan artsms plushucadventure gamecollectionik+sharewareconverterszaurusjumpmanretrodevresourcesphilipshexenfirmwareculturefujitsufinal fantasyarmgrim fandangosmartphonez-codewinuaemidiapogeetoselectronxboxgifpasswordsdebuggerdemospectravideonsfsidff7maemofm townsjeff mintertoolsc163d realms6502ndsmtxcopy protectionplus/4mediamamepinoutsuae4allendingspiratesideqlngpquasi88arcadiallamasoftbookschip8ti-89interviewsnestermultifacesinclairpatchessimcoupegeneratorreferenceolafnesfrenchcpuhomepagepc-fxemulatorsquaresoftzopharrpgsnecnetworkingmoviessnatchervaxconversionmipscodevicetoollynxxgsosxmupensfccpc.netconsolesmagnetic scrollsdtviacompatibilitydiskmagsddrdumpingemulatorsguideenginecompilerpv-1000lost sourcecomicsmapsplayerscheatsfaqsierraosf/1triviaron gilbertprogrammingaction replaymarat fayzullinvisual basicclubapple 1sdkdnacolumnseliterainbowdingooepsonfdsx1computersgamesgp2xhead over heelsemulationapple 2gscommercialwalkthroughsjrpgtrailblazerascii artfan gamesvideostechnotesxm6winampgenesis plusmagazinewikipedia8-bitoricboycott advancesnkfan fictionmetal gearjavatutorialreviewsqnxgplgamecubefaqsgiana sistersdelphimagazinesfmsxnintendographicsartworksolarisinfocomhandheldultimarpgbabysmspom1powerpcremixesgame gearinterviewdatasheetsdragonngpcwscpentagonapplespace questindiana jonesunixgallerywindowsgameopenglpc enginecocoincompletespriteszx spectrumitassemblerpalmoslittle johntvsdlwolfenstein 3dsega cdpasopiaxm7podcastddjcolecovisionhistoryjupiter acefanzinearstechnicaps2thomtranslationsmastertronicsovietunreleased32xdemo scenearchivedandroidconverterdownloadsarticlestrategymerchandisecharles macdonaldzx80humorvectrexbenj edwardsexcerptcomputingmonkey islandti-92trs-80coversarcadechronologyguidesharvesthandylucasartsvirtual boysoundtracksneopopcapcomneo4allanalysissoftwaretoolchainpc-98usabc80duke nukemsam coupépspfpcegermanstudio 2ms-doskim-1introductionnespublisherrzxmartin korthonline playaltairatari 8-bitforumpokessharpcompilationsmaking ofcatalogcartridgesbox shotsvcsacademicpreservationhi-scoresrom hacksmastergearjapanesemacrom hackfolklorescorpionpaul robsonamigamz-80video gamesralph baerjum52remakesadventure gamespc98bbc basicbbcpocketpcti-99/4ascott adamsmanual